KEGG   Bacillus cereus NC7401: BCN_0358Help
Entry
BCN_0358          CDS       T01686                                 

Definition
(GenBank) alkyl hydroperoxide reductase, subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bnc  Bacillus cereus NC7401
Brite
KEGG Orthology (KO) [BR:bnc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BCN_0358
Enzymes [BR:bnc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BCN_0358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored FAD_binding_3 Thi4 AlaDh_PNT_C DAO K_oxygenase Glutaredoxin NAD_binding_8 Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: BAL16151
LinkDB All DBs
Position
complement(403016..404542)
Genome map
AA seq 508 aa AA seqDB search
MILDADIKTQLSQYLQLMENDILLKVSAGDDDVSKDMLALVDELATMSSKITVEKVELER
TPSFSVNRPGEDTGVVFAGIPLGHEFTSLVLALLQVSGRAPKVEQKLIDQIKNIQGEYHF
ESYISLSCHNCPDVVQALNVMSVLNSGITHTMIDGAAFKEEVESKDIMAVPTVYLNGESF
GSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEYDIDVMNLQRAKRLEKKELIEVELE
NGAILKSKSVIVSTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFTGKDVAVIGGGNSGI
EAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVTVLKNVQTKEITGTDKVNGISY
IDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRGEIVTDKHGATNVPGVFAAGDCT
NNPYKQIIISMGSGANAALGAFDYLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatactagatgcagatataaaaacacaactatcccaataccttcagttaatggagaac
gatattttacttaaagtaagcgcaggagacgacgacgtatctaaagatatgttagcttta
gtagacgaattagctactatgtcatctaagattacagtagaaaaagttgaactagagaga
acaccaagctttagcgtaaaccgccctggtgaagacactggtgtcgtattcgctggtatt
ccattaggacacgaatttacttcattagtgttagctttactacaagtaagtggacgcgct
ccaaaagttgaacaaaaattaatcgatcaaattaaaaacattcaaggcgaatatcatttt
gaatcttatatcagcctaagttgtcataactgtcctgatgttgtacaagctcttaacgta
atgagcgttcttaattctggtattacacatactatgattgatggcgctgcattcaaagag
gaagtagaaagcaaagacatcatggcagtaccaactgtttacctaaacggcgaatctttc
ggaagcggtcgtatgacacttgaagaaattttagctaaaatgggtaacggtccagatgca
tcagagctttctgataaagatccatacgatgttcttgttgttggtggcggccctgctggc
gcaagtgcagcaatttatgcagcacgtaaaggcatccgcactggtatcgttgctgagcgc
ttcggtggtcaagtaatggatactatgggcattgagaacttcatcagcgtaaaacgcact
gagggtcctaagctagtagcaagccttgaagagcacgtaaaagaatacgacatcgatgta
atgaatctacaacgtgcaaaacgtttagagaaaaaagaacttattgaagtggaacttgaa
aacggcgctattctgaaaagtaagagcgtaatcgtttcaacaggtgctcgctggcgtaat
gttggcgtaccaggtgaagctgagttcaaaaataaaggtgtagcatactgcccacactgt
gacggtccattattcactggaaaagacgtagcagttatcggcggcggtaactctggtatt
gaagcagctatcgacttagcaggtattgttaagcacgtaactgttcttgaattcatgccg
gaattaaaagctgatgctgtattacaagagcgtcttaacagcttaccaaacgtaactgtt
ctgaaaaacgttcaaacgaaagaaattactggtactgataaagtaaacggtatttcttac
atcgatcgtgaaactgaagaagttcatcacgttgaattacaaggtgtattcgtacaaatc
ggtcttgttccaaacacagactggttaggcgaaacagttgagcgcgttcgcggtgaaatc
gtaacagacaagcacggcgctacaaacgtaccaggagtgtttgctgcaggtgactgtaca
aataatccgtacaaacaaatcatcatctctatgggttcaggtgcaaacgcagctttaggt
gcatttgattacttaatccgtaactaa

DBGET integrated database retrieval system