KEGG   Bacillus cereus NC7401: BCN_0574Help
Entry
BCN_0574          CDS       T01686                                 

Definition
(GenBank) neutral protease
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
bnc  Bacillus cereus NC7401
Brite
KEGG Orthology (KO) [BR:bnc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bnc01002]
    BCN_0574
Enzymes [BR:bnc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     BCN_0574
Peptidases [BR:bnc01002]
 Metallo Peptidases
  Family M4: thermolysin family
   BCN_0574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: BAL16367
LinkDB All DBs
Structure
PDB: 

Position
639386..641086
Genome map
AA seq 566 aa AA seqDB search
MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFISGDLTGATGKQA
ESVVFDYLNAAKGDYKLGEKSAQDSFKVKQVKKDAVTDSTVLRLQQVYEGVPVWGSTQVA
HVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGTKAIEIAQKDLGVTPKYEVEPKADLYV
YQNGEETTYAYVVNLNFLDPSPGNYYYFIEAESGKVLNKFNTIDHVTNDDKSPVKQEAPK
QDAKAVVKPVTGTNKVGTGKGVLGDTKSLNTTLSGSSYYLQDNTRGATIFTYDAKNRSTL
PGTLWADADNVFNAAYDAAAVDAHYYAGKTYDYYKATFNRNSINDAGAPLKSTVHYGSNY
NNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTENSSNLIYQNESGALNEAISD
IFGTLVEFYDNRNPDWEIGEDIYTPGKAGDALRSMSDPAKYGDPDHYSKRYTGSSDNGGV
HTNSGIINKQAYLLANGGTHYGVTVTGIGKDKLGAIYYRANTQYFTQSTTFSQARAGAVQ
AAADLYGANSAEVAAVKQSFSAVGIN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaagtttagcgttagtgttagcgacaggaatggcagttacaacgtttgga
gggacaggctctgcatttgcggattctaaaaatgtgctctctactaagaagtacaatgag
acagtacagtcaccggagtttatttctggggatttaactggagcaactggtaagcaagca
gaatctgttgtgtttgattatttaaacgcagcaaaaggtgattataagttaggggaaaag
agtgcgcaagattctttcaaagtgaaacaagtgaagaaagatgctgtaactgattcaaca
gtattacgtttgcaacaagtatacgaaggagtacctgtatggggttctacgcaagtagct
cacgtaagtaaagatggttctttaaaagtattgtctggaacagttgcacctgatttagac
aaaaaagaaaagttaaaaaataaaaataagatcgaaggcacaaaagcgattgaaattgcg
caaaaagatttaggggttacacctaaatatgaggtagaaccaaaagcggatttatatgta
tatcaaaacggtgaggaaacaacatatgcatacgttgtaaatctaaacttcttagatcca
agcccaggaaactactactatttcattgaagcagaaagcggtaaagtattaaataagttt
aatacaatcgatcatgtgacgaatgatgataagtcaccagttaagcaagaggctcctaag
caagatgcaaaagcagttgtaaagcctgtaacaggaacaaataaagtaggaacgggtaaa
ggggtattaggagatacgaagtcgcttaatacaacgttatctggatcatcttactactta
caagataatacacgcggagcaacaattttcacatatgatgcgaaaaaccgctcgacatta
ccaggaacattatgggcagatgcagataatgttttcaatgcagcgtatgatgcagcggca
gtagatgctcattactatgcaggtaaaacatatgattactataaagctacatttaataga
aactctattaatgatgcaggagcaccgttaaaatcaacagtccattacggaagcaattat
aataatgcattctggaacggatcacaaatggtatacggagatggtgatggtgtaacgttc
acttcattatctggtggtattgatgttattggtcacgaattaacgcatgctgttacggaa
aatagctcgaatttaatttatcaaaatgaatcaggcgcattaaatgaagcgatttctgat
atctttggtactttagtagaattctatgataaccgtaacccagattgggagattggtgaa
gatatttacacgcctggtaaagcaggagatgcacttcgttctatgagtgatccagcgaaa
tatggtgatccagaccattattctaagcgttacactggttcaagtgataacggtggggtt
catacaaacagtggcattattaataaacaagcttatttattagcgaatggcggtacgcat
tacggtgtaactgtaactggtattggtaaagataagttaggtgcaatttattaccgtgca
aacacacaatatttcacgcaatctactacatttagccaagctcgtgctggtgcagtacaa
gctgcagctgatttatatggtgcaaattctgcggaagtagcagcagttaagcaatcattt
agtgctgttggtattaactaa

DBGET integrated database retrieval system