KEGG   Bacillus cereus NC7401: BCN_2817Help
Entry
BCN_2817          CDS       T01686                                 

Definition
(GenBank) enterotoxin / cell-wall binding protein
Organism
bnc  Bacillus cereus NC7401
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3D SH3_3 SH3_4 Plasmodium_HRP SH3_1
Motif
Other DBs
NCBI-ProteinID: BAL18610
LinkDB All DBs
Position
complement(2736987..2738681)
Genome map
AA seq 564 aa AA seqDB search
MEVNMKKVIGAATATVFGLGAFTTTATAETIVTADVLNVREKPTTESKVVEKVKNGEELK
VINTEDGWSKIELNGKEVFVSSEFTKDIYHVTADLLNVRSESNTESKILGRLKKDDVIES
TKQVKDGWLQFEYKGKTAYVNVSFLSSKAPIEKKADEKTKQVAKVQKSVKAKEEAKTQKI
TKAKETIKPKEEVKVQEVAKPKEEVKVQEVAKPKEEVKVQEVAKPKEEVKVQEVAKPKEE
VKVQEVAKPKEEVKVQEVAKPKEEVKVQEVAKPKEEVKVQEVAKPKEEVKVQEVAKPKEE
VKVQEVAKPKEEVKVQEEAKAKEEAKVQEIAKAKEEVKVQEIAKAKEEAKAQEIAKAKEE
VKAQEIAKAKEEAKAREIAKAKEEAKAREIAKAKEEAKAQEIAKAKEEAKAREIAKAKEE
AKAREIAKAKEEAKAREIAKAKEEAKAREALKAKEESKNNAQSAKRELTVVATAYTADPS
ENGTYGGRVLTAMGHDLTANPNMRIIAVDPKVIPLGSKVWVEGYGEAIAGDTGSAIKGNR
IDVLMGSKSKAMNWGRQTVKVKIL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggaggttaatatgaaaaaagtaattggcgcagcaacagcaactgttttcggattggga
gcatttactacaactgctactgcagaaacgatcgtaacagcagatgtactcaacgtacgt
gaaaaaccgactacagaatcaaaagtggtcgaaaaagtaaaaaacggggaagagttaaaa
gtcatcaataccgaagatggctggtcaaaaattgagttaaatggtaaagaagtatttgta
agctcggagtttactaaagatatttaccatgtaacagcagatttgttaaatgtacgttct
gaatcaaacacagaatcaaaaattcttggcagactgaaaaaagatgatgtaattgaatca
acgaagcaagtaaaagacggatggctacaatttgagtataagggaaaaacagcttatgta
aatgtttctttcttatcaagtaaagcaccaattgaaaaaaaggctgacgagaaaacgaag
caagtagcgaaagtacaaaaatcggtgaaagctaaggaagaagctaaaacacagaagata
acaaaggcaaaagaaacaataaaacctaaggaagaagtgaaagtgcaagaagtagcgaaa
cctaaggaagaagtgaaagtgcaagaagtagcgaaacctaaggaagaagtgaaagtgcaa
gaagtagcgaaacctaaggaagaagtgaaagtgcaagaagtagcgaaacctaaggaagaa
gtgaaagtgcaagaagtagcgaaacctaaggaagaagtgaaagtgcaagaagtagcgaaa
cctaaggaagaagtgaaagtgcaagaagtagcgaaacctaaggaagaagtgaaagtgcaa
gaagtagcgaaacctaaggaagaagtgaaagtgcaagaagtagcgaaacctaaggaagaa
gtgaaagtgcaagaagtagcgaaacctaaggaagaagtaaaagtgcaagaagaagccaaa
gctaaggaagaagcgaaagtacaggaaatagcaaaggctaaggaagaagtgaaagtgcaa
gagatagccaaagctaaagaagaagcaaaagcacaagagatagccaaagctaaggaagaa
gtaaaagcacaagagatagccaaagctaaggaagaggcgaaagcacgagaaatagcaaag
gctaaagaagaagcaaaagcacgagaaatagccaaagctaaagaagaagcaaaagcgcaa
gaaatagccaaagctaaggaagaggcgaaagcacgagaaatagccaaagctaaggaagag
gcgaaagcacgagaaatagcaaaggctaaggaagaagcgaaagcacgagaaatagccaaa
gccaaggaagaggcaaaagcacgagaagcactaaaggcaaaagaagagtctaaaaataac
gcgcagtctgctaaacgtgaattaacggtggtggcgacagcatatactgctgatccgagt
gagaatggtacatatggtggacgcgttttaactgcgatggggcatgatttaacggctaat
ccaaatatgagaattatcgcagtagatccgaaagtaatcccattaggatctaaagtatgg
gtagaaggttatggagaagcaatcgctggagataccggaagtgcaattaaaggtaatcgc
attgatgtattaatgggttcaaaaagtaaagcgatgaattggggaagacaaactgttaaa
gtgaaaattttataa

DBGET integrated database retrieval system