KEGG   Bacillus cereus NC7401: BCN_4147Help
Entry
BCN_4147          CDS       T01686                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bnc01100  Metabolic pathways
bnc01110  Biosynthesis of secondary metabolites
bnc01130  Biosynthesis of antibiotics
bnc01230  Biosynthesis of amino acids
Module
bnc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bnc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCN_4147
Enzymes [BR:bnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BCN_4147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_17 Cytidylate_kin2 AAA_33 APS_kinase dNK AAA Cytidylate_kin CoaE ABC_tran KTI12 Thymidylate_kin AAA_24 Rad17 AAA_22 TsaE cobW MMR_HSR1 AAA_28 PduV-EutP AAA_14 AAA_16
Motif
Other DBs
NCBI-ProteinID: BAL19940
LinkDB All DBs
Position
complement(4003160..4003657)
Genome map
AA seq 165 aa AA seqDB search
MKSIYITGYMGAGKTTIGKALSKELHMDVIDTDQKIEEKQEKEIRDIFAEEGEMAFREYE
SEMLRSLPVENVIITTGGGIIEREENRKWMKENGTVVYLYCDPHVIAERLREDTTRPLFQ
KKDIDAFVMKFELRRAYYEEAHIHIDTTNKSVKQIMDELKEKINE
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctatatacataaccggctatatgggagctgggaaaacaacaattggaaaagca
ttaagtaaagaacttcatatggatgttatagatacagatcaaaaaattgaagagaagcaa
gagaaggagattcgtgatatttttgccgaagaaggtgaaatggcttttcgggaatatgaa
agtgagatgttacgttcactacctgttgaaaatgtaatcattacaactggcggcggaatc
attgagcgagaggaaaaccgaaagtggatgaaggaaaatggaactgtcgtgtatttatat
tgtgatccacatgtaattgcagaaaggcttcgtgaagatacgacacgtccactatttcag
aagaaagatatagatgcatttgtaatgaaattcgaattgcgccgagcttattatgaagag
gcccatatccatattgatacgacgaataagtctgtaaagcaaattatggatgaattaaaa
gaaaagattaatgaataa

DBGET integrated database retrieval system