KEGG   Bacillus cereus NC7401: BCN_4419Help
Entry
BCN_4419          CDS       T01686                                 

Definition
(GenBank) succinate dehydrogenase, iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00020  Citrate cycle (TCA cycle)
bnc00190  Oxidative phosphorylation
bnc00650  Butanoate metabolism
bnc01100  Metabolic pathways
bnc01110  Biosynthesis of secondary metabolites
bnc01120  Microbial metabolism in diverse environments
bnc01130  Biosynthesis of antibiotics
bnc01200  Carbon metabolism
Module
bnc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bnc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bnc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCN_4419
   00650 Butanoate metabolism
    BCN_4419
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BCN_4419
Enzymes [BR:bnc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BCN_4419
    1.3.5.4  fumarate reductase (quinol)
     BCN_4419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_17 Fer4_2 Fer4 Fer4_4 Fer4_3 Fer4_13
Motif
Other DBs
NCBI-ProteinID: BAL20212
LinkDB All DBs
Position
complement(4256771..4257532)
Genome map
AA seq 253 aa AA seqDB search
MSEKTIRLIITRQDGPDAQAFDQEFEIPYRPNMNIISALMEIRRNPVDSKGNKTTPIAWD
MNCLEEVCGACSMVINGKPRQSCTALIDQLEQPIRLKPMKTFPVVRDLQVDRSRMFNALK
RVKAWIPIDGTYDLGPGPRMPEKKRQWAYELSKCMTCGVCLESCPNVNSKSDFIGPAPLS
QARLFNSHPTGEMHKADRLRAIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALNRDTTI
QSFKDFFGSDNNY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaaaacaatccgcctcatcattacgagacaagacggaccagatgcgcaagcg
tttgaccaagagtttgaaattccgtatcgtccgaatatgaatattatttcggcgcttatg
gaaattcgtcgtaatcctgttgattcaaaaggaaacaaaacaactccgattgcatgggat
atgaactgtttagaggaagtatgtggtgcatgttcgatggtgattaacggaaaaccacgt
caatcatgtacagcgcttatcgatcaattagaacaaccaattcgcttaaaaccgatgaag
acattcccggttgttcgtgacttacaagttgaccgtagtcgcatgtttaatgctctaaaa
cgtgttaaagcttggattccaattgatggtacgtatgacttaggaccaggaccaaggatg
ccagagaagaaacgtcaatgggcttatgagctttcaaaatgtatgacatgtggtgtttgc
ttagaatcatgtccaaacgtaaatagtaaatcggactttattggaccagcaccgttatca
caagctcgtttatttaactcacatccaacgggtgaaatgcataaagcagatcgcttacgt
gcaattatgggtgatggaggacttgcaaactgtggtaactctcaaaactgtgtgcaatca
tgtccaaagggtattccattaacaacttcaattgcggcgttaaaccgtgatacaacaatt
caatcgttcaaagatttctttggtagcgacaataactattaa

DBGET integrated database retrieval system