KEGG   Bacillus cereus NC7401: BCN_4420Help
Entry
BCN_4420          CDS       T01686                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00020  Citrate cycle (TCA cycle)
bnc00190  Oxidative phosphorylation
bnc00650  Butanoate metabolism
bnc01100  Metabolic pathways
bnc01110  Biosynthesis of secondary metabolites
bnc01120  Microbial metabolism in diverse environments
bnc01130  Biosynthesis of antibiotics
bnc01200  Carbon metabolism
Module
bnc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bnc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bnc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCN_4420
   00650 Butanoate metabolism
    BCN_4420
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BCN_4420
Enzymes [BR:bnc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BCN_4420
    1.3.5.4  fumarate reductase (quinol)
     BCN_4420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: BAL20213
LinkDB All DBs
Position
complement(4257525..4259318)
Genome map
AA seq 597 aa AA seqDB search
MKGKLIVVGGGLAGLMATIKAAEAGVNVELFSLVPVKRSHSVCAQGGINGAVNTKGEGDS
PWIHFDDTIYGGDFLANQPPVKAMCEAAPGIIHLMDRMGVMFNRTEEGLLDFRRFGGTQH
HRTAFAGATTGQQLLYALDEQVRRHEVAGLVTKYEGWDFLRAVIDDEGVCRGIVAQDLQT
MEIRSFRADAVIMATGGPGIIFGKSTNSIINTGTAASAVYQQGAYYANGEFIQIHPTAIP
GDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVEQKL
GINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFTGDDPRKLPMKIFPAVHYSMGGLWVD
YKQMTSIPGLFAAGECDYSMHGGNRLGANSLLSAIYGGMVAGPNAIEYMKGLSKSSDAVS
STVYEQNELIETEKFNNILTLDGNENAYVLHKELGEWMTDNVTVVRENKKLLETDAKIEE
LMARYKRININDTARWSNQGASFTRQLANMFELARVITIGAYNRNESRGAHYKPEFPNRD
DANFLKTTMAKFEGEGNAPAFHYEDVDISLIKPRKRDYSSKHDVAAKSEEKGDKQHV
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggaaacttatagtagtcggcggtggcttggctggcttaatggcaacgattaaa
gcggcggaagcaggagtaaatgttgaactgttctctttagtaccagtaaaacgttcgcat
tctgtatgtgcccaaggtggaattaacggtgccgtaaatacgaaaggtgaaggggattct
ccatggatccactttgacgatacaatttatggtggggacttcttagcgaaccaaccacca
gttaaagcaatgtgtgaagcagcacctggtatcattcatttaatggaccgtatgggtgtt
atgttcaaccgtacggaagaaggacttcttgatttccgtcgttttggtggaactcaacat
caccgtacagcatttgctggtgcaacaactggacagcaattactatacgcattagatgag
caagtacgtcgtcacgaagtagcaggacttgtaacgaaatatgaaggttgggatttctta
cgagctgttattgatgatgaaggtgtgtgccgaggaatcgttgcacaagacttacaaact
atggagattagaagtttccgagctgatgccgtgattatggcaacagggggccctggtatc
atcttcggaaaatcaacaaactccattatcaatacaggtacagcagcttctgctgtatat
caacaaggcgcatattatgcaaacggtgagttcattcaaattcacccaacggcaattcct
ggagacgataaattacgtctgatgagtgaatctgcacgtggtgaaggtggacgtgtttgg
acatataaagatggtaaaccatggtatttcttagaagaaaaatatccggcttacggaaac
cttgtacctcgtgatatcgcaacgcgtgaaatctttgatgtttgcgtagagcaaaaacta
ggtattaacggtgaaaacatggtgtacttagatctttctcataaagatccgaaagaacta
gatattaaacttggtggaattattgaaatctatgagaaatttacaggtgatgatcctcgt
aaactaccaatgaaaatcttcccagctgttcactattcaatgggcgggctatgggttgat
tataagcagatgacaagcattccaggtttatttgcagcaggtgagtgtgattattctatg
cacggtggtaaccgtcttggcgcgaactcactattatcagcaatttacggtggtatggta
gcaggaccaaatgcaattgaatatatgaaaggtctttctaaatcatcagatgctgtttca
tctactgtgtatgaacaaaatgaattaatcgaaacagagaaatttaacaatattttaacg
ctcgatggtaacgaaaatgcgtatgttcttcataaagagcttggagaatggatgacagat
aacgttacagtagttcgtgaaaataaaaaattattagaaacagatgcaaaaattgaagag
ttaatggctcgctacaaacgtattaacattaacgatacagcgagatggagcaaccaaggt
gcttcatttacacgccaacttgcaaatatgtttgaattagcacgtgttattacaattggt
gcatataaccgtaatgagagccgtggggcgcattacaaacctgaattcccaaatcgtgat
gatgcaaacttcttaaaaactacgatggcgaaatttgaaggagaaggaaatgcaccggca
ttccattacgaagacgtggatatttcattaattaaaccacgtaaacgtgattattcttca
aaacacgatgtagctgctaagagtgaagagaagggggataaacaacatgtctga

DBGET integrated database retrieval system