KEGG   Bacillus cereus NC7401: BCN_5068Help
Entry
BCN_5068          CDS       T01686                                 

Definition
(GenBank) mutT/nudix family protein
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
bnc  Bacillus cereus NC7401
Brite
KEGG Orthology (KO) [BR:bnc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bnc03400]
    BCN_5068
Enzymes [BR:bnc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     BCN_5068
DNA repair and recombination proteins [BR:bnc03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BCN_5068
 Prokaryotic Type
    BCN_5068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: BAL20861
LinkDB All DBs
Position
complement(4857381..4857839)
Genome map
AA seq 152 aa AA seqDB search
MQRVTNCVLIRDNEVLLLQKPRRNWWVAPGGKMERGETVRDSVVREYREETGIYLKNPAL
KGVFTFVIQEGDKVVSEWMMFSFLATDFAGENKLESEEGIIGWHTFDKIDDLAMAPGDYH
IIDYLIKGNGIIYGTFVYTPDFELLSYRLDPS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagagtgacaaactgtgtgttaattagagataatgaagtactcttactccaaaaa
cctcgccggaattggtgggttgcaccaggcgggaaaatggagcgtggtgagacggtaaga
gattccgttgttcgcgagtatcgtgaagaaacaggtatttatttaaagaacccagcgtta
aagggggtcttcacctttgtcatccaagaaggtgataaagttgtttctgaatggatgatg
ttctcctttttagcgacagattttgcaggagaaaacaaactagagagcgaagaaggcatc
attggttggcatacatttgataaaattgatgatttagcaatggcaccaggagattatcac
attattgattatttaattaaaggaaatggcataatctacggtacatttgtatatacccca
gattttgagttgctttcatatcgattagatccgagttaa

DBGET integrated database retrieval system