KEGG   Brevundimonas naejangsanensis: DA69_01710Help
Entry
DA69_01710        CDS       T04375                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bne  Brevundimonas naejangsanensis
Pathway
bne00473  D-Alanine metabolism
bne00550  Peptidoglycan biosynthesis
bne01100  Metabolic pathways
bne01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bne00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    DA69_01710
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DA69_01710
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    DA69_01710
Enzymes [BR:bne01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DA69_01710
Peptidoglycan biosynthesis and degradation proteins [BR:bne01011]
 Precursor biosynthesis
  Amino acid ligase
   DA69_01710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: ANF53590
UniProt: A0A172Y310
LinkDB All DBs
Position
357836..358774
Genome map
AA seq 312 aa AA seqDB search
MRAPLNTLHVAVLMGGLSSEREVSLSSGRGCADALEGQAAKVTRVDAGRDLAQVLTALKP
DVVFNALHGKWGEDGCVQGILETLKIPYTHSGVLASALAMDKDKSKAVLRAAGVIVPGGG
LFDRHEVASRHVIDPPYVVKPNAEGSSVGVFLVREGANRPVAEVGAADWAYGDQVMVEPF
IAGKELAVTVLGEATGPRALTITDITPTKGFYDYEAKYAEGGSTHVLPAELPPHVFDKAL
RQAELAHAAMGCRGVSRADFRYDDVNDVLVLLEINTQPGMTSTSLAPEQAAYVGMDYREL
VRWMVEDALCPR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgcccctgaacaccctccatgtcgctgtcctgatgggcggcctgtcgtcggaa
cgcgaggtctcgctgtcctcgggtcgcggctgcgcggacgccttggaagggcaggcggcc
aaggtcacgcgcgtggacgccgggcgcgatctggcccaggtgctgacagcgctgaagccc
gacgtcgtcttcaacgccctgcacggcaaatggggcgaggacggctgcgtgcagggcatc
cttgagacgctcaagattccctacactcactccggcgtcctggcctcagcattggcgatg
gacaaggacaagtccaaggccgtgctgcgcgccgcgggcgtcatcgtgcccggcggcggc
ctgttcgaccggcacgaggtcgccagccgccacgtcatcgacccgccctatgtggtcaag
ccgaacgccgagggctcctcggtcggggtcttcctggtgcgcgagggcgccaaccgtccg
gtggccgaggtcggcgccgccgactgggcctatggcgatcaggtgatggtcgagcccttc
atcgccggcaaggagctggcggtcacggtcctgggcgaggcgaccggtccgcgcgccctg
accatcaccgacatcaccccgaccaagggcttctacgactacgaagccaaatacgccgag
ggcggctccacgcacgtcctgcccgccgagttgccgccgcacgtctttgacaaggcttta
cgccaggccgagctggctcacgcggccatgggttgccgaggggtttcccgcgccgacttc
cgttatgacgatgttaacgacgttctcgttctgttggagatcaacacccagcccggcatg
acctcgacctcgctcgctcctgagcaggcggcctatgtcgggatggattatcgcgaactg
gttcgttggatggtggaggacgccttatgcccgcggtag

DBGET integrated database retrieval system