KEGG   Brevundimonas naejangsanensis: DA69_02155Help
Entry
DA69_02155        CDS       T04375                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bne  Brevundimonas naejangsanensis
Pathway
bne03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bne00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    DA69_02155
Enzymes [BR:bne01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DA69_02155
DNA repair and recombination proteins [BR:bne03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     DA69_02155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ANF53662
UniProt: A0A172Y3D5
LinkDB All DBs
Position
453252..455786
Genome map
AA seq 844 aa AA seqDB search
MRGELKTYQAKRRFEQTPEPKGAQRAGEKDARRFVIQRHAATRLHYDFRIEADGVLKSWA
VTKAPSRDPAIKRLAVEVEDHPLDYGDFEGTIPAGNYGAGTVQLWDVGSWEPQEADLEAA
WARGQIKMILHGERLKGKWALIRLKSDRGKPSKRNNWLLLKEKDEHAVAGEGDALAQIDA
SVTTGRSLVQIAEGDAQWTSSKPTRRKAPPKPAPSKATSKAKRPHAFVPIQLCKAVDHPP
SATGWAHEIKFDGYRLQIGIGGGQAVLRTRKGLDWSDRFPELATDAAGWPDAVIDGELCA
LDDDHMPDFSALQAAISEGETDRLVYFAFDLLFEGAEDLRKLPLSHRKARLQAYIDRLGA
KKAARLRYVEHFASTGQAVLESACRMHLEGVISKKLDAPYHAGRSSSWVKSKCRGRDEVV
IGGWSSEGGSRFRSLLVGVREKGGMKYLGRVGTGFGETATRLLMPALKAEAADKSPFVGP
GAPKGGKDIHWVKPRLVAEIEHGGYTESGALRHAAFKGLRDDKTAEDVTDAPQAPAAPQA
PRKNGKVSVAGVAISSPDKVLWPGSDGRPPITKADLARYYEAAAERLLAHVADRPVSIIR
APDGIEGETFFQRHAMAGSNPRLKLIDVKARTPYVAVVDVGGLAAVAQSGGLELHPWGCK
PGDPETPDQITFDLDPDEGLDFDDVIAAALVVRAKLEALGLNPFVKTTGGKGLHLVVPIR
ADGRSRVTWDQNKAFAKAVSEAIKVEAPDRFTTTLAKKARGGKIFIDYLRNGRMATAVAP
WSPRARPGAGIAFPLSWEQVTPGLNPADYNLWVWPELLQRPDAWSGFRDSAVSLRPALRK
MGVE
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcgaactgaagacctatcaggccaagcggcggttcgagcagacgcccgaaccg
aagggcgctcaacgcgcaggcgaaaaggacgcgcggcgtttcgtgatccagcgccatgcg
gccacgaggctccactacgacttccgcatcgaggcggatggggtgctgaagtcctgggcg
gtgaccaaggccccgtcgcgtgatccggcgatcaaacgcctggcggtcgaggtcgaggac
catccgctagattacggcgacttcgaggggacgattccggcgggcaattacggggccggg
acggtgcaactgtgggacgtcggcagttgggagccgcaggaggcggacctggaggcggcc
tgggcgcgcggccagatcaagatgatcttgcacggcgagcggctgaaggggaaatgggcg
ttgatccggttgaagagcgatcggggcaagccgtccaagcgcaacaactggctgctgctg
aaggagaaggacgaacacgccgtcgccggcgaaggcgacgccctggcgcagatcgacgcc
tcggtgacgaccggacgctcgctggtccagatcgccgagggcgacgcgcaatggacgtcg
tccaaaccgacccgccgcaaggcgccgcccaagcctgcgccgtccaaggcgacgtccaag
gcgaagcggccgcacgcctttgtcccgatccagctttgcaaggctgtcgatcatccgccc
tcggcgacgggttgggcgcatgagatcaagttcgacggctatcggttgcagatcggtatc
ggcggcggccaggcggtgctgagaacccgaaagggtctggactggagcgaccggtttccc
gagttagcgacggatgcggcgggctggcccgatgcggtgatcgacggcgaactgtgcgcg
ctcgacgatgatcacatgcccgacttcagcgcgcttcaggcggcgatatccgagggagag
acggaccggctcgtctacttcgccttcgacctgttgttcgagggggcggaggatctgcgc
aagctgcccctgtcgcaccgcaaggcgcggctgcaggcctatatcgaccgactcggcgcg
aagaaggccgcgcgtcttcgctatgtcgagcatttcgcctcgacggggcaggcggtgctg
gaaagcgcctgccggatgcatctggaaggcgtgatctccaagaagctggatgcgccctat
cacgcgggccggtcgtcaagctgggtgaagtccaaatgccggggccgcgatgaggtcgtc
atcggcggctggtcgtccgaaggcggcagccgattccgctcgctgctggtcggggtgcgc
gagaagggcggcatgaaatacctcggccgggtcggcacgggtttcggcgagacggcgacg
cggttgctcatgcccgcactgaaggccgaggcggcggacaagagccccttcgtcggtccc
ggcgcgcccaaggggggaaaggacatccactgggtaaagccaaggctggtggccgagatc
gaacacggcggctacactgaatccggcgccttacggcacgcggcgttcaaggggctgcgc
gacgacaagacggccgaggacgtcacggacgcgccgcaagcgccggccgcgccgcaggcc
ccgagaaagaacggcaaggtctcggtagcgggcgtggccatatccagccccgacaaggtg
ctgtggccgggctcggacggtcgaccgcccatcaccaaggccgacctggcgcgctattac
gaggcggcggccgagcggcttctggctcatgtggcggaccggcccgtctcgatcatccgc
gcccccgacggcatagagggcgagaccttcttccagcgtcacgccatggccgggtccaac
ccccggctgaagctgatcgacgtcaaggcgcgcacgccctacgtcgccgtggtcgatgtc
ggcggtctggcggccgtggcccagtccggtggactggagctgcacccctggggctgcaaa
cccggcgatccggaaacgcccgatcaaatcactttcgatctggaccccgacgaggggctg
gacttcgacgacgtgatcgccgccgcgctggtggtcagagccaagctggaggcgctgggg
ctcaaccccttcgtcaagacgacgggcggaaaggggctgcacctggtcgtgccgatccgc
gccgacggccgctcgcgcgtcacctgggatcagaacaaggccttcgccaaggccgtgtcc
gaggcgatcaaggtcgaggcgccggaccgtttcaccaccaccctggccaagaaggcgcgg
ggcggaaagatattcatcgactatctgcgcaacggccggatggcgaccgccgtggcgccc
tggtcgccgcgcgcccggccaggcgcggggatcgcttttccgctgtcgtgggaacaggtg
acgccggggctgaacccggccgactataatctgtgggtctggcccgaactgctgcaacga
cccgacgcctggtcgggcttccgcgacagcgccgtcagcctgagacccgcgctgcgcaag
atgggcgtggaatga

DBGET integrated database retrieval system