KEGG   Brevundimonas naejangsanensis: DA69_08500Help
Entry
DA69_08500        CDS       T04375                                 

Definition
(GenBank) Hsp33 family molecular chaperone
  KO
K04083  molecular chaperone Hsp33
Organism
bne  Brevundimonas naejangsanensis
Brite
KEGG Orthology (KO) [BR:bne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bne03110]
    DA69_08500
Chaperones and folding catalysts [BR:bne03110]
 Heat shock proteins
  HSP33
   DA69_08500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 zinc_ribbon_4
Motif
Other DBs
NCBI-ProteinID: ANF54774
UniProt: A0A172Y6C5
LinkDB All DBs
Position
1798561..1799484
Genome map
AA seq 307 aa AA seqDB search
MTDHAPDAPIAAPTDDFAAAFQIEGWPVRGRLVRLGEAIDKVLSAHAYPEPVAALLGEAC
VLAAIVGSALKFDGRLIVQAQGDGPVRYVVADYGTDGHLRGFCRFDPEEVAKAAEGFARP
GAKTLLGGGVFIMTVDRGADFERTQGVTPIEGESLSLCAEHYFSQSEQVPTKVRLAVGEV
ETDQGRSWRAGGAMIQVIAGDESRGSTEEVWERTRALFATLGDDELIDPTISAETLLYRL
FHEDGVRLEGAKALAAVCRCSKDRIATVLQSFPTEERAEMVEDDGKIRVTCEYCSAVYDI
DPEEITG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatcacgcgcccgacgcccccatcgccgcccccacggacgacttcgccgccgcc
ttccagatcgaaggctggccggtgcgcggccgcctggtccgcctgggcgaggcgatcgac
aaggtgctgtcggcccacgcctatccggaaccggtcgccgccctgctgggcgaggcctgc
gtgctggcggccatcgtcggctcggcgctgaagttcgacggccgcctgatcgttcaggcc
cagggcgacggcccggtgcgctatgtcgtggccgactacggcaccgacgggcatctgcgc
ggcttctgccgcttcgatcctgaagaagtggccaaggccgccgaaggcttcgcacgtccg
ggcgccaagaccctgttgggcggcggcgtcttcatcatgacggtggatcgcggcgccgac
tttgaacgcacccaaggcgtaacccccatcgagggcgaaagcctgtcgctgtgcgccgaa
cactatttctcccagtccgagcaggtgccgaccaaggtgcgcctggccgtcggcgaggtc
gagacggaccagggccgatcctggcgcgccggcggggcgatgatccaggtcatcgccggc
gacgagtcgcgcggctcgaccgaggaggtgtgggagcgcacccgcgccctgttcgccacc
ctgggcgacgacgagctgatcgacccgaccatcagcgccgagaccctgctgtatcgcttg
ttccacgaggacggcgtgcggctggaaggcgccaaggcgctggccgcggtctgccgctgc
tcgaaggaccgtatcgccaccgtgctgcaatccttcccgacggaagaacgcgccgagatg
gtcgaggacgacggcaagatccgcgtgacgtgcgaatattgctcggccgtttatgacatc
gacccggaagagatcaccggctga

DBGET integrated database retrieval system