KEGG   Brevundimonas naejangsanensis: DA69_12760Help
Entry
DA69_12760        CDS       T04375                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bne  Brevundimonas naejangsanensis
Pathway
bne00620  Pyruvate metabolism
bne00680  Methane metabolism
bne01100  Metabolic pathways
bne01120  Microbial metabolism in diverse environments
bne01200  Carbon metabolism
Module
bne_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DA69_12760
  09102 Energy metabolism
   00680 Methane metabolism
    DA69_12760
Enzymes [BR:bne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DA69_12760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ANF55532
UniProt: A0A172Y8Q9
LinkDB All DBs
Position
complement(2654789..2657494)
Genome map
AA seq 901 aa AA seqDB search
MSQTSEFPHDRLRDEVRLLGALLGEVIRDEGGQALYDRIEAVRKASVAYHRDPASDDASE
LERLLGDLSLDQAIGLTHGFAAFSLLANVAEDRAGKRRAQAQAEAGERADTPEGVLKRLA
EAGVDRGAVRDLLSRALISPVLTAHPSEVRRKSVIDRTAAVGELLDGCDRDGIACDPETL
KAALRRQIVILWATRLTRASAPVVQDEIDIVVDWLRRIFLHVAPAQLAEWRRLLGAPDLT
PFVRIGSWVGGDRDGNPNVDADTLRAAFRSQARAALGFYLDEVHALGAELSLSIDLTRVT
PELAALAQGSGDASIQRADEPYRRALSQIYARLSAAYPALTGEPTPRPARFKAPPYDGPN
AFRADLNILHDSLVRTHGAVFADDRLARLITAADVFGFHMATLDLRQNSDVHERVVADLL
KVAGVCPDYAALDEAERLAVLARELTSPRPLFSPYADYAPETLKERAILQAAAEALSTFG
PQAIRTHIVSKTDAASDMLEVYLLLKEVGLYDPADAAACPIQAAPLFETIDDLRAARATL
ERVLAEPSARAVAEARGVQEVMIGYSDSNKDGSYLTSGWELHEASRALLEVTRAAGVRLQ
LFHGRGGAVGRGGGSSFSAVLGQPAGTVAGRIRVTEQGEVIANKYGEPEVAQRNLDALTC
GTLLASLGPQSDAGYSARYGETAARLSAASMKAYRALVYETPGFVDYFRAATPIAEIADL
KIGSRPASRTASPAIEDLRAIPWVFSWSQSRVMLPGWYGFGSAVRGEDPAELRAMAETWP
FFRTVIQNMEMVMAKADMAVARRYAGLVPDPALAERIYASIRAEWDRTVAAVLSITGQDA
LLGGQPELDRLIRQRMPYVEPLNHVQIELIRRRRAGDDDPRVSNGILLAINGVAAGLRNS
G
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgagccagacttcggaatttccccacgaccgcctccgcgatgaggttcggcttctgggc
gccctgctgggcgaggtgatccgcgacgagggcggacaggcgctctacgaccggatcgaa
gccgtgcgaaaggcgtccgtcgcctatcaccgcgacccggcctcggacgatgcttcggaa
ctggagcgtctgctgggcgacctgtcgctggatcaggccatcggcctgacgcatggtttc
gccgccttctccctgctggccaatgtcgcagaggaccgggcgggcaagcgccgcgcccag
gcccaggccgaggcgggagagcgggcggacacccccgaaggcgtgcttaaacgactggcc
gaagcgggcgtcgacaggggcgcggtgcgcgaccttctgagccgggccctgatctcgccg
gtgctgaccgcccacccgtccgaggtgcgccgcaagagcgtcatcgaccgcacggcggcg
gtcggcgaactgctggacggctgcgaccgcgacgggatcgcctgcgatcccgaaacgctg
aaggcggccctgcgccgtcagatcgtcatcctgtgggccacgcggctgacccgcgcctcg
gcgccggtggtgcaggacgagatcgacatcgtggtcgactggctgcggcgcatcttcctg
catgtcgccccggcccagctggccgaatggcggcgcctgctgggggcgcccgatctgacg
cccttcgtgcgcatcggctcctgggtcggcggcgaccgcgacggcaacccgaacgtcgac
gccgacaccctgcgcgccgccttccgcagtcaggcccgcgccgcgctcggcttctatctg
gacgaggtgcacgccctgggcgccgagctcagcctgtccatcgacctgacccgcgtcacg
cccgaactggccgccttggcgcaaggctcgggcgacgcctccatccagcgcgcggacgaa
ccctatcgccgggcgctcagccagatctacgcccgcctgtcggccgcctatccggccctg
accggcgagccgacgccgcgtccggcccgatttaaggctccgccctatgacggtcccaac
gccttccgcgccgacttgaacatcctgcacgacagtctggtgcggacccacggcgccgtc
ttcgccgacgaccgactagcgcgactgatcacggcggcggacgtgttcggcttccacatg
gcgacgctggacctgcgccagaactccgacgtgcatgagcgcgtggtcgccgacctgctg
aaggtcgcgggcgtctgccccgactacgccgccctggacgaagctgagcggctggccgtg
ctggcgcgcgagctgaccagcccgcgccccctgttctctccgtatgcggactatgccccc
gagacgctgaaggagcgcgccatccttcaggccgccgccgaggctctttcgacgttcggc
ccgcaggcgatccgcacccacatcgtgtccaagaccgacgccgcttcggacatgctggag
gtctatctgctgctcaaggaagtcggcctctacgacccggccgacgcggccgcctgcccc
atccaggccgcgcccctgttcgagaccatcgacgacctgcgcgccgcccgcgccacgctt
gagcgggtccttgccgagccgtccgcccgcgccgtggccgaggcgcgcggggtgcaggag
gtgatgatcggctattccgacagcaacaaggacggctcctacctgacctcgggctgggag
ttgcacgaggcctcgcgcgccctgctagaggtcacgcgcgcggcgggggtgcggctgcag
ctgttccatgggcgcggcggcgccgtggggcgcggcggcggatcaagcttctcggccgtg
ctgggccagcccgccgggacggtggcgggccgcatccgcgtcaccgaacagggcgaggtc
atcgccaacaaatacggcgagccggaggtggcccaacgcaacctcgacgccctgacctgc
gggacgctgctggcctcgctggggccgcaatcggacgccggctacagcgcgcgctatggc
gaaacggccgcgcgcctgtcggccgcctcgatgaaggcctatcgggccctcgtctatgag
acgccgggcttcgtcgactatttccgcgccgccacccccatcgccgagatcgccgacctg
aagatcggctcgcgcccggccagccgcaccgcctcgcccgccatcgaggacctgcgcgcc
attccgtgggtgttcagctggtcgcagtcgcgggtcatgctgcccggctggtacggcttc
ggctcggcggttcggggcgaagacccggccgaactgcgcgccatggccgaaacctggccc
ttcttccgcaccgtcatccagaacatggagatggtcatggccaaggccgacatggccgtc
gcccggcgctacgccggcctggtccccgaccccgctctggccgagcgcatctatgcttct
atccgcgccgaatgggaccgcaccgtcgccgccgtcctgtccatcaccggccaggacgcc
ctgctgggcggtcagcccgaactggaccggctgatccgccagcggatgccttatgtcgag
ccgctgaaccatgttcagatcgagctgatccgccgccgccgcgcaggcgacgatgatccg
cgcgtcagcaacggcatccttctggccatcaacggcgtggcggcaggcctcagaaacagc
ggttga

DBGET integrated database retrieval system