KEGG   Brevundimonas naejangsanensis: DA69_12795Help
Entry
DA69_12795        CDS       T04375                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bne  Brevundimonas naejangsanensis
Pathway
bne00061  Fatty acid biosynthesis
bne00780  Biotin metabolism
bne01100  Metabolic pathways
bne01130  Biosynthesis of antibiotics
bne01212  Fatty acid metabolism
Module
bne_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bne00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DA69_12795
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DA69_12795
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    DA69_12795
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bne01004]
    DA69_12795
Enzymes [BR:bne01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DA69_12795
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     DA69_12795
Lipid biosynthesis proteins [BR:bne01004]
 Fatty acid synthase
  Component type
   DA69_12795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: ANF55539
UniProt: A0A172Y8H4
LinkDB All DBs
Position
complement(2663094..2663915)
Genome map
AA seq 273 aa AA seqDB search
MATSEGWDMPTGELMKGKKGLIMGVANSNSIAWGIASQLAAQGAELAFTYLGEGLERRVR
PLAESVGAKLLIQADVTDDASMDAAFAELEKEFGTIDFVVHSVAFANKDELKGSFVDNTT
RDSFLLAMNISAFSFVDVAKRSAKLMPNGGSMITLTYLGSERVIPNYNTMGVAKAALEAA
TRYIARDLGPKGIRVNAISAGAMRTLSLAGIAGGRGLHSKSAQFSLIKEETSMEGVAGAA
LWLCSDLGRSTTGEVVHVDAGFHAVGLPDDMEG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgagcgaaggctgggacatgcccaccggcgaactcatgaagggcaagaagggc
ctgatcatgggggtggccaactccaactccatcgcctggggcatcgcctcgcagctggcc
gcccagggcgccgagctggccttcacctatctgggcgagggtcttgagcgccgcgtgcgc
ccgctggccgaaagcgtcggcgccaagctgctgatccaggctgacgtcaccgacgacgcc
tcgatggacgccgccttcgccgagctggagaaggagttcggcacgatcgacttcgtcgtc
cactcggtggccttcgccaacaaggacgagctgaagggctccttcgtcgacaacaccacc
cgcgacagcttcctgctggccatgaacatctcggccttcagcttcgtcgacgtggccaag
cgctcggccaagctgatgcccaacggcggctcgatgatcaccctgacctacctcggctcc
gaacgggtcatcccgaactacaacaccatgggcgtggccaaggccgcgctggaagccgcc
acccgctatatcgcgcgcgatctcggtccgaagggcatccgcgtcaacgccatctcggcg
ggcgccatgcgcaccctgtcgctggcgggcatcgccggcgggcgcggcctgcactccaag
tcggcgcaattctcgctgatcaaggaagagacctcgatggaaggcgtcgccggcgccgcc
ctgtggctgtgctcggatctgggccgctcgaccacgggcgaagtcgtccacgtcgacgcc
ggcttccacgccgtcggcctgccggacgacatggagggctga

DBGET integrated database retrieval system