KEGG   Brenneria nigrifluens: EH206_00615Help
Entry
EH206_00615       CDS       T06070                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
bng  Brenneria nigrifluens
Pathway
bng02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bng00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EH206_00615
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bng02000]
    EH206_00615
Transporters [BR:bng02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    EH206_00615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 oligo_HPY AAA_16 AAA_22 AAA_29 Sigma54_activat Mg_chelatase AAA_25 NACHT IstB_IS21 RsgA_GTPase AAA_7 DUF87 RNA_helicase FtsK_SpoIIIE TniB AAA_5 AAA_24 ATP-synt_ab AAA_33 T2SSE CbiA MMR_HSR1 NB-ARC AAA PRK AAA_23 DUF2075
Motif
Other DBs
NCBI-ProteinID: QCR02850
LinkDB All DBs
Position
complement(145441..147078)
Genome map
AA seq 545 aa AA seqDB search
MNKLEHNAPVLQIADLQVALPADADRPYAIQRLDLAIEAGKTLCVVGESGSGKSVLATTI
MGLMAKELRINSGTIRLAGNTLLDSGHYASNRRMRQLRATSMGMVFQEPMTALNPVHSCG
EQVDELLRAHTHWPAAERKARILAMFERVRLPDPARIYKSYPHQLSGGQRQRIVIAMAIV
LKPQLLICDEPTTALDVTTQAEILKLIRELQAEQGSAVLFITHDMGVVSEIADHILVMYR
GEIVEQGACEQVLRHPATDYTRSLLAAVPDITPPPPRQPPGNRLPPLLVGQSVGKTYVSR
DWLGRSKRFDALRQASVAVHRGETVGIVGESGSGKSTFARCMIRMIAPSSGKILWGDREV
QTLPESQVRTLRSRVQVVFQDPNRSLNPRRTIGSSIMEGAMNFGQSRQQARHTAEALMDR
INLPHASLDRYPHQFSGGQRQRLAIARAIACDPQVLVADEAVSALDVSVQAQILDLLREL
QRDLGLGLLFITHDLRVAAQLCDRVMVMHQGEVVEQGITAQLFGQPRHDYTRRLLAAAPR
LMLMK
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcttgaacataacgccccggtgttgcaaatcgccgacctacaggtagccctg
ccggcggatgccgaccgcccgtacgccattcaacggctcgatctggcgatcgaggccggg
aaaacgctgtgcgtggtcggcgaatcgggttcgggaaaatcggttctggccaccaccatc
atgggattgatggccaaagagctgcgcatcaacagcggcaccatcaggctggcgggcaat
acgctgctggattcaggccattacgccagcaaccggcggatgcgccagctgcgcgccacc
agtatggggatggtttttcaggagccgatgaccgcgttgaatccggttcatagctgcgga
gaacaggttgatgagctgctgcgcgcgcatacccactggcccgccgccgaacgcaaggcc
agaatattggcgatgttcgagcgggtgcgtctgcccgacccggcgcgtatctacaaaagc
tatccgcaccagctctcaggcggccaacgccagcgcatcgttatcgcgatggcgatcgtt
ctcaaaccgcagttgctgatttgcgacgaacccaccaccgcgctggacgtcaccacgcaa
gcggaaatccttaagctgatccgcgaactccaggcggaacagggcagcgcggtgcttttc
attacccatgatatgggcgtggtctcggaaatcgccgaccacatcctggtgatgtatcgc
ggcgagatagtggaacagggcgcctgcgaacaggtgctgcgacatccggccaccgactat
acccgttcactgctggcggcggtgcccgatattacgccgccgccgccgcgccagccgccc
ggcaatcgcctcccgccgctgctggtgggccagtcggtcggcaaaacctatgtcagccgc
gactggctggggcgcagtaaacgcttcgacgccctgcggcaggccagcgtcgcggttcac
cgcggcgaaaccgtcggcatcgtgggggaatccggctcggggaaatccaccttcgcacgc
tgcatgatccgcatgatcgcgcccagttcgggcaagatcctgtggggagaccgcgaagta
caaaccttacccgaatcgcaggtgcggacattgcgttcgcgcgttcaggtggtttttcag
gatccgaaccgatcgctgaatccgcgccgcaccatcggatcttcgatcatggaaggcgcg
atgaattttggtcagagccggcagcaggcccgccacaccgccgaagcgttgatggaccgc
atcaacctgccgcacgcgtcgctcgatcgctatccgcatcagttttccggcgggcaacgg
caacggctggccatcgcccgcgccatcgcctgcgatccccaggtgctggtggcggatgaa
gccgtctccgcgctggacgtgtcggtacaggcgcaaatcctcgatctgctgcgcgaatta
cagcgggatttgggattggggctgctgttcatcacccacgatctgcgcgtcgccgcccag
ctttgcgatcgcgtcatggttatgcatcagggagaggtggttgagcaaggcatcaccgcc
cagctattcggccagccccggcatgactacacgcgccgcctgctggctgcggcgccgcgt
ttgatgttgatgaaataa

DBGET integrated database retrieval system