KEGG   Brenneria nigrifluens: EH206_02870Help
Entry
EH206_02870       CDS       T06070                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bng  Brenneria nigrifluens
Brite
KEGG Orthology (KO) [BR:bng00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EH206_02870 (ahpF)
Enzymes [BR:bng01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EH206_02870 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 Glutaredoxin DAO Thi4 FAD_binding_3 K_oxygenase NAD_binding_7 DSBA FMO-like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: QCR03243
LinkDB All DBs
Position
625422..626990
Genome map
AA seq 522 aa AA seqDB search
MLDNTMKVQLKAYLEKLTKPVELIATLDDSAKSLEVRELLTEIAGLSEQVSFSEQNDLAV
RKPSFLITNPGSQSGPRFAGAPMGHEFTSLILALLQVGGHPSKEAQELLDQIRNLDGSFH
FETYYSLSCHNCPDVVQALNLMAVLNPNITHTAIDGGVFQDEIQSRNVMGVPTVFLNGEH
FSQGRMSLGEIVTKIDTGASEKQVEKLNQRPVYDVLIVGSGPAGAAAAVYAARKGIRTGL
IGERFGGQILDTVDIENYISVPKTEGAKLATALKSHVDDYDVDVIDAQSVEALIPGGQAG
AAHQVVTVSGAVLKSRSVIIATGARWRNMNVPGEDQYRTRGVTYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQDKLRSLPNVDIIVNAQTTEVQGD
GQKVTGLAYKDRVSDTQHQLPLEGIFVQIGLLPNTNWLEGTVARNRIGEIEIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTQPAE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaatacaatgaaagtccagttaaaagcttacctggaaaaattaaccaaacct
gttgagttaattgcgactctggatgactcggccaaatccctggaagtcagggaattactg
acggagatcgcaggattatctgagcaggttagtttctctgaacagaatgacctggcagtg
cgtaaaccctcctttttgattaccaacccaggttcacagagcggcccgcgttttgccggc
gccccgatgggacatgagttcacctcgctgattctggcgctgttgcaggtgggcggtcat
ccgtcgaaagaagcgcaggagttgctcgaccagatccgcaatcttgacggatcgttccat
ttcgaaacctattattcgctctcctgtcacaactgtccggacgtggtgcaggcgctgaat
ttgatggcggtgctgaatcccaacattacccataccgccattgacggcggcgtgtttcaa
gatgagatccagagccgcaacgtgatgggcgtgccgaccgtgttcctcaacggcgagcac
ttcagccaggggcgcatgagcctcggcgaaatcgtgaccaaaatcgataccggcgcgagc
gaaaagcaggttgaaaagctgaatcagcgcccggtgtacgatgtgctgattgtcggcagc
ggcccggcaggcgcggcggcggcggtctatgcggcccggaaaggcatccgtaccggtctg
atcggcgaacgtttcggcggtcagatattggataccgtggacattgaaaactacatttcc
gtaccgaaaacggaaggggccaagctggcgaccgcgctgaaaagccacgttgatgattac
gatgtggatgtgattgacgcgcagagcgttgaagccttgatccccggcggccaagcgggg
gcggcgcatcaggtggtgaccgtgtccggcgcggtactgaagtcccgcagcgtcatcatc
gccaccggcgcccggtggagaaacatgaacgtgcctggcgaagatcagtaccgcacccgc
ggggtgacctactgtccgcactgcgacggcccgctgtttaaaggcaagcatgtggcggtg
atcggcggcggtaactccggcgtggaagcggcgatcgatctggccggggtggtgaagcac
gttaccctgctggagttcgcgccggagctgaaggcggactccgtattgcaggacaaattg
cgcagcctgccgaatgtcgacatcatcgttaacgcgcagaccacggaagtgcaaggcgac
ggacagaaagtcaccggtctggcctataaggatcgcgtcagcgatacgcagcaccaactg
ccgctggaagggatcttcgtgcagatcggcctgctgcccaacaccaactggctggaaggt
acggtcgcccgcaacaggatcggcgaaattgaaattgacgccaagtgcgaaaccagcgtc
aaaggggtatttgccgccggcgactgcaccaccgtgccgtacaaacagatcatcatcgcc
accggcgaaggggcgaaagcctcgctaagcgcgtttgattatctgatcagaacgcaaccc
gccgagtga

DBGET integrated database retrieval system