KEGG   Brenneria nigrifluens: EH206_07895Help
Entry
EH206_07895       CDS       T06070                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
bng  Brenneria nigrifluens
Pathway
bng02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bng00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EH206_07895
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bng02000]
    EH206_07895
Transporters [BR:bng02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    EH206_07895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 AAA_22 SMC_N AAA_16 AAA CbiA TniB MobB AAA_7 AAA_30
Motif
Other DBs
NCBI-ProteinID: QCR04107
LinkDB All DBs
Position
1715619..1716620
Genome map
AA seq 333 aa AA seqDB search
MTLLTVSQLTVENPQGIALVDRVSLTLEQGEILGLVGESGSGKTITCRALMRLLPGDGLR
IAGGDILLRDKSLLTLSERQMTAMRGRQIGMIFQNPASHLNPVMTIGQQIAESRRLHFAA
GRREARRQAVALLRQVGIADPQRRVDNYPHEFSGGMRQRAMIAVALACEPAVLIADEPTT
ALDVTVQMQILRLLNELRDRLGIAVILITHDLGVVAQTCDRIAVMYGGRLCEIGDKRQLL
AGPLHPYTRGLIDCQPVSEGGYGRLRTIAGQPPLAERFPSGCRFHPRCQYAQGDCRLTQP
PMRAQQTAHAHGAACHHPLPPGMQACDGRNNGQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacgctattgactgtgtcgcagttaaccgttgaaaatccgcagggcatcgcgctggtc
gatcgtgtctcgctgacgctcgaacagggggagattctcggtctggtgggcgaaagcgga
tccggtaaaaccattacctgccgggcgctgatgcggctgctgcccggcgacgggctgcgt
atcgccggaggcgatatcctgctgcgcgataagtcgctgttgacgctgagtgaacggcag
atgacggccatgcgcggacggcaaatcggcatgattttccagaaccccgccagccatctc
aatccggtgatgaccatcggtcagcagatcgccgagagccgccgcctgcactttgcggcc
ggtcgccgtgaagcccgacggcaggcggtggcgctgttgcgccaggtcggtattgccgat
ccgcagcggcgggtggataactatccccatgaattttccggcggcatgcgccagcgggcg
atgatcgccgtggcgctggcctgcgaacccgccgtgctgattgccgatgaaccgacgacg
gcgctggacgtcaccgtccaaatgcagatcctacgcctgctgaacgaactgcgcgatcgg
ctgggcatcgcggttatcctgatcacccacgatctgggcgtggtggcgcaaacctgcgat
cgcatcgccgttatgtacggcgggcggttatgtgaaatcggtgataagcgtcagctgctg
gccgggccgttacatccgtatacccgcggactgattgactgccagccggtcagcgaagga
ggctatgggcggctgcggaccattgcggggcagccgccgcttgccgagcgtttcccctcc
ggctgccgttttcacccgcgttgccagtacgctcaaggggattgtcgcctcacgcagccg
ccgatgcgggcacagcagacggcgcacgcccacggggctgcctgtcatcatcccttgccg
cccggcatgcaggcatgcgacgggaggaataatggtcagtaa

DBGET integrated database retrieval system