KEGG   Brenneria nigrifluens: EH206_09070Help
Entry
EH206_09070       CDS       T06070                                 

Gene name
fabI
Definition
(GenBank) enoyl-ACP reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bng  Brenneria nigrifluens
Pathway
bng00061  Fatty acid biosynthesis
bng00780  Biotin metabolism
bng01100  Metabolic pathways
bng01130  Biosynthesis of antibiotics
bng01212  Fatty acid metabolism
Module
bng_M00083  Fatty acid biosynthesis, elongation
bng_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bng00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EH206_09070 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    EH206_09070 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    EH206_09070 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bng01004]
    EH206_09070 (fabI)
Enzymes [BR:bng01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     EH206_09070 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     EH206_09070 (fabI)
Lipid biosynthesis proteins [BR:bng01004]
 Fatty acid synthase
  Component type
   EH206_09070 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: QCR04315
LinkDB All DBs
Position
complement(1963422..1964213)
Genome map
AA seq 263 aa AA seqDB search
MGFLTGKRILVTGVASNRSIAFGIAQAMHREGAELAFTYQNDKLKSRVEGFAGELGSSIV
LPCDVAEDASIEALFVELAKVWPNFDGFVHSIAYAPAEQLDGDYVDAVTREGFGVAHDIS
SYSFVAMAKACRKMLNPNSALVTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGAQ
GVRVNAISAGPIRTLAASGIKNFKKMLSHCEAVTPIRRVVTIEDVGNSAAFLCSDLAAGI
SGEVLHVDGGFNIAAMNELELDN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcttaccggtaagcgcattctggtcactggcgtcgccagtaaccgctccatt
gcattcggtatcgcacaggccatgcaccgcgagggtgccgaactggcgttcacgtatcag
aacgataagctaaaatcgcgcgttgaaggctttgccggcgaactgggttccagcattgtg
ctgccgtgcgacgtcgcggaagacgccagtattgaagcgctgtttgtcgaactggccaaa
gtctggccgaactttgacggtttcgtgcactccatcgcttacgcgccggccgaacagctt
gacggcgattatgtcgatgcggtaacccgcgagggcttcggcgtggcgcacgatatcagc
tcatacagctttgtggcgatggcgaaggcctgccgcaagatgctgaacccgaattccgct
ctggtgaccctatcctatctgggcgcagagcgcgccattcccaactataacgttatgggt
ctggcgaaagcgtcgctggaagcgaacgtacgctacatggcgaacgccatgggcgcgcag
ggcgtgcgcgttaacgccatttccgccggcccaatccgtacgctggccgcatcaggcatc
aagaacttcaagaaaatgctgtcgcactgtgaagcggttacgccaatccgccgcgtcgtc
accatcgaagacgtcggcaattccgcggcgttcctgtgctccgatctggcggccggcatc
tccggcgaagtgctgcacgtggacggcggctttaacatcgccgcgatgaacgagctggaa
ctggataattaa

DBGET integrated database retrieval system