KEGG   Bifidobacterium animalis subsp. animalis ATCC 25527: BANAN_00365Help
Entry
BANAN_00365       CDS       T02047                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bni  Bifidobacterium animalis subsp. animalis ATCC 25527
Pathway
bni00620  Pyruvate metabolism
bni00680  Methane metabolism
bni01100  Metabolic pathways
bni01120  Microbial metabolism in diverse environments
bni01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BANAN_00365
  09102 Energy metabolism
   00680 Methane metabolism
    BANAN_00365
Enzymes [BR:bni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BANAN_00365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFI62300
LinkDB All DBs
Position
complement(77011..79767)
Genome map
AA seq 918 aa AA seqDB search
MTDQEQTITPADATIVTSGLGTKGPEERTLPATLQEDMDLCLNILREVLSEYDENLLKTF
DTVRQYAVDASAERFSGVLTDTHPERDDLEMAVKTIDAMNLHDAQLLARAFATYFHLANL
CEENYRVAVLHEREAKVDDTQAIDPVNEMTKAYHQLISEMGPAKAKELLERLEFHPVFTA
HPTEARRKAVEGKIRRIAQLLEAHRLLGGSDKKENSRRLYNEIDALFRTSPIALKKPTPV
EEADTILDIFDNTLFHTIPMVYRRFDDWVLGDKAGIEPPACPAFFHPGSWIGSDRDGNPN
VTAKVSRQVARKFSDHVLAALEEATRTVGRNMTVESETTPPSDELHTLWNQQKEISERLT
GKASLISTKELHRAVLLVMADRLHYTIKRDTDLMYHNCDDFLADLRVVQRSLAEAGDKRA
AYGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALDDIREHGLHGERGPLQPMTHEVLDT
FRALGAIQKRNGVKAARRYIISFTKSAKNVRDVYELNRLAFSNPDDAPVIDVIPLFEQLE
DLENSVSVLDEMLKIPEVQARLKQTGRKMEVMLGYSDSSKDAGPTTATLALHSAQERIAK
WADENDIDLTLFHGRGGAVGRGGGPANRAVLAQPKGSVKCRFKLTEQGEVIFARYGNPVL
AIRHVESVAAATLLQSAPSVEKTNTEMTEKYKPMADQLSEVSHETFLDLLNSEDFAPWFS
IVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGSACESFG
DLATLRKAYEEWPLFSTFIDNIEMSLAKTDERIAKMYLALGDRPDLSKKVLDEMELTRKW
VLKIVGDEWPLQHRHVLGQAIRIRSPYVDALSVTQVLALRSLRKKVDKEELSESQLAGFI
YLILCTVSGVAAGLQNTG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcaagagcaaacgatcacgccggccgatgccacgatcgtgacgtccgggctc
ggcaccaaaggtcccgaagagcgcacgcttcccgcgacattgcaggaagatatggacttg
tgtctgaacattctgcgcgaagtgctttccgaatacgacgagaatctcctcaaaacgttt
gacaccgtgcgtcaatatgccgtcgatgccagcgccgaacggttctccggcgtgctcacc
gacacccatcccgagcgcgatgatctcgaaatggccgtcaagacgatcgatgcgatgaat
ctgcacgacgcccagctgctcgcccgcgcgttcgccacgtacttccatctggcgaatctg
tgcgaggaaaactaccgtgtggccgtgctccatgagcgtgaggccaaggtggacgacact
caggccatcgatccggtgaacgagatgacgaaggcataccaccagctcatctccgaaatg
ggcccggccaaggccaaggagctgctcgaacgcctcgaattccacccggtgttcaccgcg
caccccaccgaggcgcgccgcaaggccgtggaaggcaagatccgccgcatcgcacagctg
ctcgaagcacaccgtctgctcggcggctccgacaagaaggagaacagccgtcgcctgtac
aacgagattgacgcactgttccgcacgtcgccgattgcgctgaagaagccgacgcctgtc
gaagaggccgacacgattctcgacatcttcgacaacacgctgttccacacgattccgatg
gtctaccgtcgtttcgatgactgggtgctcggcgacaaggccggcatcgagccgccggca
tgccccgcgttcttccacccgggcagctggatcggttccgaccgcgacggcaacccgaac
gtcaccgccaaggtgagccgtcaggtggcccgcaagttcagcgaccatgtgctcgccgcg
ctcgaggaggccacgcgtaccgtcggccgcaacatgaccgtcgaatccgagaccacgccg
ccgagcgatgagctgcacacgctgtggaaccagcagaaggagatcagcgagcgactcacc
ggcaaggcgtcgctcatctccacgaaggaactgcatcgtgcggtgctgctcgtcatggcc
gaccgcctgcattacacgatcaagcgcgacaccgatctcatgtaccacaactgcgacgac
ttcctcgcggatcttcgcgtggtgcaacgttcgctcgccgaggccggcgacaagcgcgcc
gcctacggcccgctgcaggacctcatctggcagaccgagaccttcggcttccacatggtc
gaaatggagttccgtcagcattcggtggtgcacgcgcgtgccctcgacgacattcgcgag
catggcctgcatggcgaacgtggaccgttgcagccgatgacacatgaggtgctcgacacc
ttccgtgccctcggcgcgattcagaagcgcaatggcgtcaaggccgcccgtcgctacatc
atctcgttcacgaagagcgcgaagaatgtgcgcgacgtgtacgagctcaaccgtctggcg
ttctcgaacccggacgacgccccggtgatcgacgtgatcccgctgttcgaacagctcgag
gatctcgagaactcggtctcggtgctcgacgagatgctgaagattcccgaggtgcaggcc
cgactcaagcagaccggccgcaagatggaggtcatgctcggctactcggattcatcgaag
gacgccggccccaccaccgccacgctcgcgctgcactccgcgcaggagcgcattgcgaag
tgggcggacgagaacgacatcgatctgacgctgttccacggccgcggcggcgccgtcggt
cgcggcggcggtccggccaaccgcgcggtgctcgcacagccgaagggttcagtcaagtgc
cgcttcaagctcaccgagcagggcgaggtcatcttcgcccgctacggcaatccggtgctc
gccatccgccacgtcgagtccgtggccgccgcgacgctgttgcagtcggctccgagcgtg
gagaagacgaacaccgagatgaccgagaaatacaagccgatggcggatcagctcagcgaa
gtttcacatgaaacgttccttgatctgctcaacagcgaggacttcgcaccgtggttctcg
atcgtcacgccgctgaccgagatcggcttgctgccgatcggttcccgccctgcgaagcgc
ggcttgggagccaagtcgctcgacgatctgcgtacgattccatggatcttctcgtgggcc
caggcccgcatcaacctcgccgcctggtatggcctcggctccgcatgcgagtcgttcggc
gacctcgccacgctgcgcaaggcatacgaggaatggccgctgttctccaccttcatcgac
aacatcgagatgtcactggcgaagaccgacgaacgcatcgcgaagatgtaccttgcactc
ggcgaccgcccggacctctcgaagaaggtgctcgacgagatggagctcacacgcaagtgg
gtgctcaagatcgtgggcgacgaatggcctctgcagcaccgtcatgtgcttggccaggcg
attcgcatccgctccccgtacgtcgacgcactgtctgtcacgcaggtgctcgcattgcgt
tcgctgcgtaagaaggtcgacaaggaggagctctccgaaagccagctggcaggattcatc
tacctgattctgtgcaccgtttcgggtgtcgccgccggcctgcagaacaccggctga

DBGET integrated database retrieval system