KEGG   Bifidobacterium animalis subsp. lactis CNCM I-2494: BALAC2494_00139Help
Entry
BALAC2494_00139   CDS       T01842                                 

Definition
(GenBank) Non-specific serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bnm  Bifidobacterium animalis subsp. lactis CNCM I-2494
Brite
KEGG Orthology (KO) [BR:bnm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bnm01001]
    BALAC2494_00139
Enzymes [BR:bnm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BALAC2494_00139
Protein kinases [BR:bnm01001]
 Serine/threonine kinases: Other
  Bacterial family
   BALAC2494_00139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kinase-like Haspin_kinase Kdo Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AEK30557
LinkDB All DBs
Position
1274751..1276976
Genome map
AA seq 741 aa AA seqDB search
MVDTTAHGTDHYNLIDGRYRIVRKIADGGMATVYQTVDERLGRNVAVKIMHMQLAQGPHR
EQFIERFRREAKSAAAIANPHVVQVYDTGETNGSYYLVMEYVHGVNLRSQMQTHTTFSVR
DTLRIVGETLNGLAAAHEIGVVHRDIKPENILINDRGHVEITDFGLAKAASQATLSSTGM
LLGTAAYLAPEMIENNQATPQGDCYSVGIMAWELLAGRVPFQSDNPVTMVFRHVNENIPS
IGTVCYGIDPRVSAFISYLTARDVNARPKSAQKALDRLRELMPTLSRQALDYRFRPQEPP
INSTRVFPMGANEQDSDRPSVSSKSDSPEESTPPPTSAAALFTALASPDLTEEEAEQART
VALATPPDDSSTPGSGVPASGGTTVPPYGGSTGSYGRNSGRPGEPGAPLPSNAQTQVQPR
KKHRTAMIVSIIAAILALGAGGGFALWYFVGPGSYWTLPKPEGLSCAENAPCKITGVKWD
AYERLLKVSQIPYKSTQQYSDTVPAGEIISTDPQFVDAHVSKRASGEVHVTVSQGVQQAT
VPEGIMSSSSPLDDLRKAGFTNITHSEDNDEYSESVPEGEVIDITPSAGTTQNHNDDVVV
TLSKGPMPVAMPNVVGMTRGQAQKSFDDAKLKATYTEEYSDTIPRDQVISVDPEAGTQLH
WGDAVTVTVSKGPEMVTVPDITGKKTEEARKILEDLGFEVKVSSPLGDLLHTVRFQDPKG
GQQVRLRGEDGKKTVITLTVI
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggtggataccacggcacacggcacggaccactacaatctcattgacggccgctaccgc
attgtgcgcaagatcgcggatggcggcatggccacggtgtaccagaccgtcgacgaaagg
ctcgggcgcaatgtggcggtcaaaatcatgcacatgcagctggcccagggcccccaccgc
gagcagttcatcgagcgcttccgacgggaggccaaatccgcggcagcaatagccaatccg
catgtggtgcaggtgtacgacaccggtgagacgaatggctcgtactatctggtcatggag
tatgtgcacggcgtgaatctgcgtagtcagatgcagacgcacaccacgttctcggtgcgc
gacaccctgcgcatcgtcggcgagacattgaacggacttgccgccgcccacgagatcggc
gtcgtacaccgcgacatcaagccggagaacattctgatcaacgaccgcggtcatgtggag
atcaccgatttcggcctagccaaggccgcctcgcaggccacgctctcctccaccgggatg
ctgcttggcacagcggcctatctcgccccggagatgatcgaaaacaaccaggccactcct
cagggcgactgctattccgtgggcatcatggcatgggagctgctggcggggagggtgccg
ttccagtcagacaatccggtgacgatggtgttcaggcacgtcaacgagaacatcccctcc
ataggaacggtgtgctacggcatcgacccccgggtttcggccttcatctcgtacctgacc
gcacgtgacgtcaatgcccgtccgaaaagcgcacagaaggcgttggatcgcctccgtgag
ctcatgcccacgctgagccgccaggcattggactatcgcttccgcccccaggaaccaccc
atcaacagcactcgggtgttcccaatgggtgcgaatgagcaggattccgaccgtccctcc
gtttcgagcaaatcggattcgccggaagaatccactccaccacctacctctgccgccgcg
cttttcactgcattggcctcccccgatctcactgaagaggaggcggaacaggcaagaacg
gtagctctcgccacaccgccggacgactcctcgacgccaggctctggggttccggcctcc
ggtggaaccaccgttccaccatatggaggctctaccggaagttatgggcgtaattccggc
cgtcccggcgagccaggtgcgccattgcccagcaatgcccagacgcaagtgcagcctcgc
aagaagcatagaacggcgatgatcgtttcgatcatcgccgccatactcgcattgggtgcc
ggtggcggattcgcattgtggtacttcgtggggcctggcagctactggacactgcccaaa
cccgaggggctcagttgtgccgaaaatgcgccatgcaagatcacaggtgtgaaatgggat
gcctatgagcgtctgctcaaagtctcgcagattccgtacaaaagcacacagcagtatagc
gacacagtgcctgccggcgagatcatctccaccgacccgcaatttgtggatgcccatgtg
agcaagcgggccagcggcgaggtgcatgtgacggtgtcgcaaggtgtgcagcaggccacc
gttcccgaaggcatcatgagcagctcgtcccctctggacgacctgcggaaggcgggcttc
accaacatcacgcacagcgaagacaacgacgagtattccgaaagcgttccggaaggcgag
gtcatcgacatcacgcccagcgccggcaccacacagaaccataacgacgacgtcgtggtg
acgctctccaaagggcccatgccggtggcaatgccgaatgtggtgggcatgacgcgcggt
caggcgcagaagtcgtttgatgacgccaagctcaaggcgacctacaccgaagagtacagc
gatacgattccacgggaccaggtgatttcagtggatcccgaggcgggaacccaattgcac
tggggcgatgcggtcacagtcaccgtctcgaagggccctgaaatggtgaccgttcccgac
atcacgggcaagaagacggaggaggccaggaagatccttgaagacctcggctttgaggtg
aaggtctcatcaccgttgggcgacctcctgcacaccgtgcgattccaagatcccaaaggc
ggccagcaggtgcgtctgcgtggcgaagacggcaagaaaacggtgatcacactcacggtg
atctga

DBGET integrated database retrieval system