KEGG   Bacteroides ovatus: Bovatus_02336Help
Entry
Bovatus_02336     CDS       T04113                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
boa  Bacteroides ovatus
Pathway
boa00240  Pyrimidine metabolism
boa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Bovatus_02336 (tdk)
Enzymes [BR:boa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Bovatus_02336 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK FUR
Motif
Other DBs
NCBI-ProteinID: ALJ46969
UniProt: A0A139L104
LinkDB All DBs
Position
2861725..2862324
Genome map
AA seq 199 aa AA seqDB search
MVLFSEDHIQETRRRGRIEVICGSMFSGKTEELIRRMKRAKFAKQRVEIFKPAIDTRYSE
EDVVSHDSHSIASTPIDSSASILLFTSEIDVVGIDEAQFFDSGLIDVCNQLANNGIRVII
AGLDMDFKGNPFGPMPQLCAIADEVSKVHAICVKCGQLASFSHRTVKNEKQVLLGETAEY
EPLCRECYLRARGEDEQKV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggtattattttcagaagaccacatacaggagactagaagaagaggccggatcgaagta
atctgcggttctatgttctccggaaagacagaggaattgattcgcagaatgaagagagcg
aaattcgcgaaacaacgtgtcgagatattcaaacctgctatcgacacccgttattcagaa
gaagacgtagtctctcacgacagccattctatcgcctccactcccatcgattcgtcagcc
agcattttactgtttacttctgagatagatgtagtaggtattgatgaagcacagttcttc
gacagcggtttgattgatgtatgcaaccagcttgccaacaatggaatccgtgttatcatt
gcaggattggatatggacttcaaaggaaatccgttcggacctatgccacaattgtgcgcc
attgccgatgaagtctccaaagttcatgcgatctgtgtgaaatgtggtcagctggcttct
ttctcacatcgtacagtcaagaatgagaaacaggttcttttaggcgaaacagccgaatat
gaacctctgtgcagggaatgttatctccgtgcacgaggggaagatgagcagaaagtataa

DBGET integrated database retrieval system