KEGG   Bacteroides ovatus: Bovatus_02904Help
Entry
Bovatus_02904     CDS       T04113                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
boa  Bacteroides ovatus
Brite
KEGG Orthology (KO) [BR:boa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bovatus_02904 (ahpF)
Enzymes [BR:boa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Bovatus_02904 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_binding_2 Thi4 Thioredoxin_3 FAD_oxidored DAO AlaDh_PNT_C NAD_binding_7 NAD_binding_8 FAD_binding_3 Lycopene_cycl K_oxygenase Glutaredoxin PLD_C
Motif
Other DBs
NCBI-ProteinID: ALJ47514
UniProt: A0A5M5A1X9
LinkDB All DBs
Position
complement(3560151..3561701)
Genome map
AA seq 516 aa AA seqDB search
MLESALKEQLKGIFAGLEANFTFDISVSSSHENKTELLELLGDVADCSDHITCSVNEGEA
LKFTLLKNSDRTGITFRGIPNGHEFTSLLLAILNLDGKGKNFPDEAVCNRVKALKGPIHL
TTYVSLTCTNCPDVVQALNAMTTLNPAITHEMVDGALYQDEVDALKIQGVPSVFADGKLL
HVGRGEFGELLAKLEDQYGIDETKANAEVKEYDVIVVGGGPAGVSAAIYSARKGLRVAIV
AERVGGQVKETVGIENLISVPETTGNELADNLKTHLLRYPVDLLEHRKVEKVEVVGKQKQ
ITTSVGEKFLAPALIIATGASWRKLNVPGEAEYIGRGVAFCPHCDGPFYKGKHVAVVGGG
NSGIEAAIDLAGICSKVTVFEFMDELKADSVLQERLKSLPNVEVFVSSQTTEVIGNGDKL
TALRIKDRKTEEERLVELDGVFVQIGLSANSSVFRDIVETNRPGEIMIDAHCRTNVTGIY
AAGDVSTVPYKQIIISMGEGAKAALSAFDDRVRGII
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttagaatctgcattaaaagaacaactaaagggtatttttgctgggctggaggcaaac
tttacttttgatatatccgtatcatccagccacgaaaacaaaacagaattattggagttg
ctgggagatgtagcggattgttccgatcatatcacttgctcggtgaatgagggagaagca
ttgaagtttactttattaaagaatagtgatcgtaccggaatcacattccggggtattcct
aacggacatgagttcacatcattgcttttggctatcctgaatctggacggcaaaggaaag
aactttcccgatgaggccgtttgcaaccgtgtgaaagcactgaaaggcccgatacatctg
accacttatgtttcgttgacttgtacgaactgccctgacgtagtgcaggctctgaatgca
atgactactttgaatccggctattacgcatgaaatggtagacggtgcgctttatcaggat
gaagtagatgcactgaagatacaaggagtaccctctgtctttgcagatggaaaattgctt
catgtaggccgtggtgaatttggcgaattgcttgccaagttggaagatcaatatggtatt
gacgaaaccaaagcgaatgcagaggtgaaagaatatgatgtgattgtagtcggtggagga
cctgcaggagtatcagcagctatttattctgcccgtaaaggactccgtgtagctatcgtg
gccgagcgtgttggcggacaggtaaaagaaacggtgggtattgaaaatctaatttctgtt
ccggaaacgacaggaaatgaacttgccgataatctgaaaactcacttgttgcgttatccg
gtggatttgctggagcatcgtaaagtagaaaaagtagaagtggttggaaaacaaaagcag
atcactacctctgttggggagaaattcctggctccggcactgattattgcaactggtgca
agctggcgtaaactgaatgttccgggagaagcggagtatatcggtcgtggtgttgctttc
tgccctcattgtgatgggccgttttataagggaaagcatgtagcagtagtaggtggagga
aattccggcattgaggcagcgattgacttggctggtatctgctccaaagtcactgttttt
gaatttatggatgagttgaaagcagacagtgtacttcaagagcgacttaaatcattgccg
aatgtggaagtgtttgtaagttcacagactacggaagtgataggaaatggtgataagctg
actgccctgcgcatcaaagaccgcaaaacggaagaagaacgtttggttgagttggatggt
gtatttgtacaaatcgggctttctgcgaatagcagtgtattccgcgacatagtggaaacc
aaccgtccgggcgaaatcatgattgatgcacattgccgtacgaatgtgacgggtatctat
gcagccggagatgtttctacggttccttataagcaaattattatctctatgggcgaagga
gcgaaagctgcgctttctgcatttgacgatagagtgagagggattatctga

DBGET integrated database retrieval system