KEGG   Bacteroides ovatus: Bovatus_03808Help
Entry
Bovatus_03808     CDS       T04113                                 

Definition
(GenBank) Retaining alpha-galactosidase precursor
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
boa  Bacteroides ovatus
Pathway
boa00500  Starch and sucrose metabolism
boa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bovatus_03808
Enzymes [BR:boa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Bovatus_03808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: ALJ48413
UniProt: A0A1Y4Q1A2
LinkDB All DBs
Position
complement(4912885..4915101)
Genome map
AA seq 738 aa AA seqDB search
MKKKKFFSIIAFLCISFIANAQQKLTSPDGNLVLTFQVNKEGAPTYDLTYKGKVVIKPST
LGLELKKEDNTRTDFDWVDRRDLTKLDSKSNLYNGFKLKDAQTTTFDETWQPVWGEEKEI
RNQYNELAVILFQPMNDRSIVVRFRLFNDGLGFRYEFPQQKSLNYFVIKEEHSQFAMAGN
HIAYWIPGDYDTQEYDYTISRLSEIRGLMQQAITPNSSQTPFSPTGVQTALMMKTDDGLY
INLHEAALIDYSCMHLNLDDKNMIFESWLTPDAKGDKGYMQTPCNSPWRTIIVSDDARNI
LASRITLNLNEPCKIADAASWIKPVKYIGVWWDMITGKGSWAYTDELTSVKLGVTDYSKT
KPNGKHSANTANVKRYIDFAAANGFDAVLVEGWNEGWEDWFGNSKDYVFDFLTAYPDFDV
QEIHRYAASKGIKMMMHHETSASVRNYERHLDKAYQFMVDNGYNSVKSGYVGNIIPRGEH
HYGQWMNNHYLYAVKKAADYKIMVNAHEATRPTGICRTYPNLIGNESARGTEYESFGGNK
VYHTTILPFTRLVGGPMDYTPGIFETHCNQMNPANNSQVRSTIARQLALYVTMYSPLQMA
ADIPENYERFMDAFQFIKDVALDWDKTIYLEAEPGEYITIARKAKGTDDWYIGCTAGENG
HDSQLTFDFLEPGKQYVATVYADAKDADWKDNPQAYTIKKGILNNKSKLNLHAANGGGYA
ISIKEVKNKSEVKGLKRL
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaaagtttttttcgatcatcgcattcctttgcatctcattcattgcgaat
gcacaacagaaactgacctcaccggatggcaatctggttctgacctttcaggttaacaaa
gaaggcgcaccaacctacgacttgacttacaaaggcaaggtggtaattaagccgagcact
ctcggactggaattgaaaaaagaagataataccagaaccgactttgactgggtagaccgc
agagacctcaccaagctcgattctaaatccaatctttataatggcttcaagctgaaagat
gcgcaaacgactacctttgacgaaacctggcaaccagtctggggagaagaaaaggaaatc
cgcaatcagtataacgaactggcagtcattctgtttcagccaatgaacgaccgttccatc
gttgttcgcttccgcctgttcaatgatggtttgggattccgttatgaatttccgcaacag
aaatcactgaactacttcgttatcaaggaagaacattcccaatttgccatggcaggcaac
catatcgcatactggataccgggcgattacgacactcaagagtacgactacaccatctcc
cgtctatcggaaatcagaggtttgatgcaacaggcgatcactccaaattcttctcaaacc
ccattttcaccgacaggtgtacagacggcactgatgatgaaaacagatgatggtttatac
atcaatctgcacgaagccgctttgattgattattcttgtatgcacctcaatctggacgac
aaaaacatgatattcgaatcctggctgacaccggatgcaaaaggggataaaggttacatg
cagactccgtgcaactctccgtggcgtacgatcatcgtcagtgatgatgcacgtaacatt
ctcgcctcccgcatcaccctcaacctgaacgaaccttgtaagattgcagacgccgcctcc
tggattaaaccggtgaaatatataggcgtatggtgggacatgattaccggaaaaggttcc
tgggcttatacagatgaactgaccagcgtgaaacttggcgttacagactactccaaaacc
aaaccgaacggcaaacattctgccaatacagctaacgtgaaacgttacatcgactttgcc
gcagccaacggatttgatgcagtgctggtagaaggttggaatgaaggatgggaagactgg
ttcggcaacagcaaagactatgtatttgacttcctgactgcatatcctgatttcgacgta
caggaaatccatcgttatgccgcaagcaaaggaattaaaatgatgatgcaccatgagact
tctgcatctgttcgcaactacgaacgtcacctggataaagcttaccaattcatggtagac
aatggatataactcggttaaaagcggttatgtgggtaatatcattccacgcggagaacat
cattacggtcaatggatgaataatcattacctgtatgccgtgaaaaaagccgccgattat
aaaatcatggtcaatgcacacgaagcaacccgtccaaccggtatctgccgtacatatccc
aatctgatcggtaatgaatccgcacgtggaacagaatatgaatcatttggaggaaataaa
gtataccacacgacgattctgcctttcacacgcctggtcggtggtccgatggattacact
cccggcatcttcgagactcactgtaaccagatgaatccggcaaacaactcccaggtacgt
tcaaccattgcacgccaactggcattgtatgtcaccatgtatagccctttgcagatggct
gccgatattccggaaaactacgaacgctttatggatgctttccagtttatcaaagacgtc
gctctcgactgggacaaaacaatctatctggaagcagaaccgggagaatacatcacaatt
gcccgcaaagcaaaaggaacggacgactggtacataggctgcacagccggtgaaaacggc
cacgactcccaattaacgttcgatttcctggaaccgggaaaacaatacgtcgctaccgta
tacgcagatgccaaagatgccgactggaaagataacccgcaggcatacaccatcaaaaaa
ggtatcttgaataataaaagcaaactgaatctgcacgctgccaatggcggtggatacgca
atcagtatcaaagaggtgaaaaacaaatcagaggttaagggattgaaaagactataa

DBGET integrated database retrieval system