KEGG   Burkholderia oklahomensis C6786: BG90_1641Help
Entry
BG90_1641         CDS       T03861                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00010  Glycolysis / Gluconeogenesis
boc01100  Metabolic pathways
boc01110  Biosynthesis of secondary metabolites
boc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:boc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BG90_1641 (acoD)
   00620 Pyruvate metabolism
    BG90_1641 (acoD)
Enzymes [BR:boc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BG90_1641 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AJX30576
LinkDB All DBs
Position
I:complement(1820776..1822296)
Genome map
AA seq 506 aa AA seqDB search
MNHADMQHLNIEFPYRKQYGNFIGGEWVAPVGGEYFDNVSPVTGQPFTAIPRSREADVEL
ALDAAHAAKAGWAATSAGERANALLRIADRMEANLTRLAVAETIDNGKPLRETTAADVPL
AIDHFRYFAGCIRAQEGSIADIGGDMVAYHFHEPLGVVGQIIPWNFPLLMAAWKLAPAIA
AGNCVVLKPAEQTPASILVFAELIQDLLPPGVLNIVNGFGLEAGKPLASSKRIAKIAFTG
ETSTGRLIMQYASENLIPVTLELGGKSPNIFFADVMDRDDGYFDKALEGFAMFALNQGEV
CTCPSRALVEESIYERFMERALKRVESIKQGHPLDAQTMIGAQASSEQLEKILSYIDIGR
KEGAQCLTGGERNVLGGELSEGYYVKPTVFRGHNKMRIFQEEIFGPVLAVTTFKSEEEAL
EIANDTLYGLGAGVWTRDGNRAYRVGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYSEKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcggacatgcaacatctgaacatcgaatttccgtaccgcaagcaatacggg
aatttcatcggcggcgaatgggtcgccccggtcggcggcgagtatttcgacaacgtctcg
cccgtgaccggccagccgttcaccgcgatccctcgctcgcgcgaagcggacgtcgagctc
gcgctcgacgccgcgcacgccgcgaaggccggctgggccgcgacgagcgcgggcgagcgc
gcgaacgcgctgctcaggatcgccgaccggatggaggcgaacctcacgcgcctcgcggtc
gccgagacgatcgacaacggcaagccgctgcgcgagacgaccgcggccgacgtgccgctc
gcgatcgaccacttccgctacttcgcgggctgcatccgcgcgcaggaaggctcgatcgcc
gacatcggcggcgacatggtcgcctatcacttccacgagccgctcggcgtcgtcggccag
atcatcccgtggaacttcccgctgctgatggccgcgtggaagctcgcgcccgcgatcgcg
gccggcaactgcgtcgtgctgaagccggccgagcagacgcccgcgtcgatcctcgtgttc
gccgagctgatccaggatctgctgccgcccggcgtgctgaacatcgtcaacggcttcggg
ctcgaggcgggcaagccgctcgcgtcgagcaagcggatcgcgaagatcgcgttcacgggc
gagacgtcgacgggccgcctcatcatgcagtacgccagtgaaaacctgatccccgtcacg
ctcgagctcggcggcaagagcccgaacatcttcttcgccgacgtgatggaccgcgacgac
ggctacttcgacaaggcgctcgaaggcttcgcgatgttcgcgctcaaccagggcgaggtc
tgcacgtgcccgtcgcgcgcgctcgtcgaggagagcatctacgagcgcttcatggaacgc
gcgctcaagcgcgtcgaatcgatcaagcaaggccacccgctcgacgcgcagacgatgatc
ggcgcgcaggcgtcgtccgagcagctcgaaaagatcctgtcgtacatcgacatcggccgc
aaggaaggcgcgcagtgcctgacgggcggcgagcgcaacgtgctcggcggcgagctgtcg
gaaggctattacgtgaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaagagatcttcgggccggtgcttgcggtgacgacgttcaagtccgaggaggaagcgctc
gagatcgcgaacgacacgctgtacggtctgggcgcgggcgtctggacgcgcgacggcaac
cgcgcataccgcgtcggccgcggcatccaggcgggccgcgtgtggacgaactgctatcac
gcgtatccggcgcatgcggcgttcggcggctacaagcagtcggggatcggccgcgagacg
cacaagatgatgctcgaccactaccagcagacgaagaacctgctcgtcagctacagcgaa
aagccgctcgggttcttctga

DBGET integrated database retrieval system