KEGG   Burkholderia oklahomensis C6786: BG90_1846Help
Entry
BG90_1846         CDS       T03861                                 

Definition
(GenBank) AAA domain protein
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
boc01100  Metabolic pathways
boc01110  Biosynthesis of secondary metabolites
boc01130  Biosynthesis of antibiotics
boc01230  Biosynthesis of amino acids
Module
boc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:boc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BG90_1846
Enzymes [BR:boc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BG90_1846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 AAA AAA_25 FtsK_gamma AAA_16 AAA_22 APS_kinase TsaE Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: AJX31558
LinkDB All DBs
Position
I:2034234..2034788
Genome map
AA seq 184 aa AA seqDB search
MQARDPHVNVIFVGLMGAGKTTVGRAVARRLDRPFFDSDHEIEARTGARIPVIFELEGEA
GFRDREAQMIAELTQRENIVLATGGGAILRSENRELLHSRGLVVYLRANPHDLWLRTRKD
KNRPLLQTDDPKAKLEALYEARDPLYRECAHFVIETGRPSVNGLVNMVLMQLEMAGIVAK
PIQA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagcgcgggacccacacgtgaacgtaattttcgtcgggctcatgggggcgggtaag
accaccgtgggccgggcggtcgcgcgccggctcgacagaccgttcttcgattcggatcac
gagatcgaggcgcgcacgggtgcgcgcattccggtcatcttcgaactcgaaggcgaggcc
ggcttccgcgaccgcgaggcgcagatgatcgccgagctcacgcagcgcgagaacatcgtg
ctggcgacgggcggcggcgcgattttgcgttccgaaaaccgcgaactcttgcattcgcgc
ggccttgtcgtctatctgcgcgcgaatccgcacgacctctggctgcgcacgcgcaaggac
aagaaccgcccgctgttgcaaaccgacgatccgaaagccaagctcgaagcgctgtacgaa
gcgcgcgatccgctctatcgcgaatgcgcgcacttcgtcatcgagaccggccgtccgtcc
gtcaacgggctcgtcaacatggtgctgatgcagctcgagatggcgggcatcgtcgccaag
ccaatacaagcatga

DBGET integrated database retrieval system