KEGG   Burkholderia oklahomensis C6786: BG90_2008Help
Entry
BG90_2008         CDS       T03861                                 

Definition
(GenBank) penicillin binding transpeptidase domain protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00550  Peptidoglycan biosynthesis
boc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:boc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BG90_2008
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BG90_2008
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:boc01011]
    BG90_2008
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:boc03036]
    BG90_2008
Enzymes [BR:boc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BG90_2008
Peptidoglycan biosynthesis and degradation proteins [BR:boc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BG90_2008
Chromosome and associated proteins [BR:boc03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BG90_2008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AJX32178
LinkDB All DBs
Position
I:2208635..2210479
Genome map
AA seq 614 aa AA seqDB search
MKPASKRTQGVKFASSPVLSVHLPMWRSKLVVFMLFMAFVALAVRAFWIQGPGNAFYQKQ
GESRYQRTLELPATRGKILDRNGLVLATSLPVRAIWAIPADVPDDLGVDKVDALGKLLGM
TTKELKAKLSEDKTFVYVKRQVPLDVADQVAKLDIPGVYQRGEYKRFYPEGEITAHLIGF
TNVEDEGQEGVELADQKLLVGTPGSRHVIKDRVGHIVEDVDAQVPPHNGSDVGLSIDSKI
QYITYTNLKAAVEKFHAKAGAAMVIDVQTGEVLSLVNYPTYNPNDRSHLTGEQLRNRVLT
DVFEPGSIMKPFTVSLALDLHRVTPNTLVDTGNGHFVLDGAPITDDSGFGTLTVGGVIQK
SSNIGATKIAMTMKPEEMWNMYTSIGLGQAPKVGFPGAAAGRLRPWKNWRRIEQATMSYG
YGLSVSLFQLARAYTAIAHDGELMPVTIFKTNDAQPATGPRIFSPTTAREVRTMLESVVS
PQGTSPNAAVPGYRVGGKSGTAYKQVGRGYDHKKYRASFVGMAPMPNPRIVVAVSVDEPT
MGGHFGGQVSGPVFSAIAGDTLRALNVPPNMPVKQLVVSDDTANAAAPQKLAGAAPAKHM
IVSSTTHNRPGVVR
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccgcgtcgaagcgcacgcaaggcgtgaagttcgcatcgagcccggtgctgtcg
gtccatctgccgatgtggcgctcgaagctcgtcgtgttcatgctgttcatggcgttcgtc
gcgctcgccgtgcgcgcgttctggatccaggggcccggcaacgcgttctatcagaagcag
ggcgaaagccgctatcagcgcacgctcgaattgccggcgacgcgcggcaagatcctcgat
cgcaacggtctcgtgctcgcgacgagcctgcccgtgcgcgcgatctgggcgattccggcc
gacgtgcccgacgacctcggcgtggacaaggtcgacgcgctcggcaagctgctgggtatg
acgacgaaggagctgaaggcgaagctgtcggaagacaagacgttcgtctacgtgaagcgc
caggtgccgctcgacgtcgccgaccaggtcgcgaagctcgacatccccggcgtctatcag
cgcggcgaatacaagcgcttctatccggaaggcgagatcaccgcgcacctgatcggcttc
acgaacgtcgaggacgaagggcaggagggcgtcgagctcgccgatcagaagctgctcgtc
ggcacgccgggcagccgccatgtgatcaaggaccgcgtcgggcacatcgtcgaggacgtc
gacgcgcaggtgccgccgcacaatggcagcgacgtcggcctgtcgatcgacagcaagatc
cagtacatcacgtacacgaacctgaaggcggccgtcgagaagttccacgcgaaggcgggc
gcggcgatggtgatcgacgtgcagacgggcgaggtgctgtcgctcgtcaattatccgacg
tataacccgaacgaccgctcgcacctgacgggcgaacagctacgcaaccgcgtgctgacc
gacgtgttcgagccgggctcgatcatgaagccgttcacggtatcgcttgcgctcgacctg
catcgcgtgacgccgaacacgcttgtcgacacgggcaacggccatttcgtgctcgacggc
gcgccgatcaccgacgactcgggcttcggcacgctgacggtcggcggcgtgatccagaaa
tcgagcaacatcggcgcgacgaagatcgcaatgacgatgaagcccgaggaaatgtggaat
atgtatacgagcatcgggctcgggcaggcgccgaaggtcggttttcccggcgcggcggcg
ggccggctgcgtccgtggaagaactggcggcggatcgagcaggcgacgatgtcgtacggc
tacggcctgtcggtgtcgctcttccagctcgcgcgcgcgtacaccgcgatcgcgcacgac
ggcgagctgatgcccgtcacgatcttcaagacgaacgacgcgcagcccgcgaccggtccg
cggatcttctcgccgacgacggctcgcgaggtgcgcacgatgctcgagtccgtcgtgtcg
ccgcaggggacgtcgccgaatgcggcggtgccgggctaccgcgtcggcggcaagagcggc
accgcttacaagcaggtcggccgcggctatgatcacaagaagtatcgcgcgtcgttcgtc
ggaatggcgccgatgccgaatccgcgcatcgtcgtcgcggtgtcggtcgacgagccgacg
atgggcggccacttcggcggccaggtgtcaggccccgtgttctcggcgatcgccggcgat
acgctgcgcgcgctgaacgtgccgcccaacatgccggtcaagcagctcgtcgtgtcggac
gatacggcgaacgccgccgccccgcagaagctggccggcgccgcgcctgcaaaacacatg
atcgtgtcgagcacgacacacaaccgtcctggagtcgttcgatga

DBGET integrated database retrieval system