KEGG   Burkholderia oklahomensis C6786: BG90_2858
Entry
BG90_2858         CDS       T03861                                 

Definition
(GenBank) hypothetical protein
  KO
K11007  shiga toxin subunit B
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:boc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BG90_2858
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:boc02042]
    BG90_2858
Bacterial toxins [BR:boc02042]
 Type III toxins: Intracellular toxins
  Others
   Shiga toxin
    BG90_2858
SSDB
Motif
Pfam: LPAM_1
Other DBs
NCBI-ProteinID: AJX33199
LinkDB
Position
I:3156116..3156388
AA seq 90 aa
MKKTLAAIVSALLLASSYAHADTLCTSGTINKLFIDNNGVMEVTVGNLSYLNGNKDAYPL
INSAFVMGKQVYIYASTCQPGTSMGGFAVR
NT seq 273 nt   +upstreamnt  +downstreamnt
atgaaaaagactctcgctgctatcgtttcagccttgcttctggcttcgtcctatgcgcac
gcggatacgttgtgcacgtcgggcacgatcaacaagctcttcatcgacaacaacggggtc
atggaggtcaccgtcggcaacctgtcctacttgaacggaaacaaggatgcgtatccgctc
atcaattcggcgttcgtgatgggcaagcaggtctatatctacgcgagcacttgccagccg
ggcacatcgatgggaggctttgccgttcggtaa

DBGET integrated database retrieval system