KEGG   Burkholderia oklahomensis C6786: BG90_3256Help
Entry
BG90_3256         CDS       T03861                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00010  Glycolysis / Gluconeogenesis
boc00053  Ascorbate and aldarate metabolism
boc00071  Fatty acid degradation
boc00280  Valine, leucine and isoleucine degradation
boc00310  Lysine degradation
boc00330  Arginine and proline metabolism
boc00340  Histidine metabolism
boc00380  Tryptophan metabolism
boc00410  beta-Alanine metabolism
boc00561  Glycerolipid metabolism
boc00620  Pyruvate metabolism
boc00625  Chloroalkane and chloroalkene degradation
boc00903  Limonene and pinene degradation
boc01100  Metabolic pathways
boc01110  Biosynthesis of secondary metabolites
boc01120  Microbial metabolism in diverse environments
boc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:boc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BG90_3256
   00053 Ascorbate and aldarate metabolism
    BG90_3256
   00620 Pyruvate metabolism
    BG90_3256
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BG90_3256
   00561 Glycerolipid metabolism
    BG90_3256
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BG90_3256
   00310 Lysine degradation
    BG90_3256
   00330 Arginine and proline metabolism
    BG90_3256
   00340 Histidine metabolism
    BG90_3256
   00380 Tryptophan metabolism
    BG90_3256
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BG90_3256
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BG90_3256
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BG90_3256
Enzymes [BR:boc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BG90_3256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2007
Motif
Other DBs
NCBI-ProteinID: AJX31532
LinkDB All DBs
Position
I:3641552..3642988
Genome map
AA seq 478 aa AA seqDB search
MKIYEQFYIGGAWRPSAGNGTIDVIDSGTEAVIGRVPEGTAEDAKAAVAVARAAFDGWAA
TPPAERARYLYKITENLKARSEELAQSITGEVGMPIKLSRAIQVGGPVYNWGAYAKLAET
FAFEEQVGNSLVVREPVGVVAAITPWNYPLNQITLKVAAALAAGCTVALKPSEIAPLNAF
MLAEAIHDAGLPAGVFNLVCGYGPVVGEALASDPDVDMVSFTGSTRAGKRVAELAAAGVK
RVALELGGKSASVILDDADFAAAVKGTVSACYLNAGQTCSAHTRMLVPESRYDEARELAK
AAAEAYVAGDPRDDATRLGALASAVQQARVQDYIRRGIDEGAELVTGGLGMPEGLTRGFF
VKPTVFGRVKPDATIAQEEIFGPVLSIVTYRDDDDAVRIANDSPYGLGGAVWSGSDEHAL
RVARRIRTGQVDINGGAWNMAAPFGGFKQSGIGRENGVYGLEEYLEYKSMQLRPKKNA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaagatctacgaacagttctacatcggcggcgcgtggcgcccgagcgccggcaacggc
acgatcgacgtgatcgactccggcacggaggccgtgatcggccgcgttcccgagggcacc
gccgaagacgcgaaagcggccgtcgccgtcgcgcgcgccgcgttcgacggctgggccgcg
acgccgcccgccgagcgcgcccgctatctctacaagatcaccgaaaacctgaaggcgcgc
agcgaggaactcgcgcagtcgatcacgggcgaagtcggcatgccgatcaagctgtcgcgc
gcgatccaggtcggcgggccggtctacaactggggcgcgtatgcgaagctcgccgagacg
ttcgcgttcgaagagcaggtcggcaattcgctcgtcgtgcgcgagccggtcggcgtcgtc
gcggcgatcacgccgtggaactatccgctcaaccagatcacgctgaaggtcgcggccgca
ctcgcggcaggctgcaccgtcgcgctgaagccgtccgaaatcgcgccgctcaatgcgttc
atgcttgccgaagcgattcacgatgccgggctgcccgccggcgtgttcaacctcgtatgc
ggctacgggcccgtcgtcggcgaagcgctcgcgagcgatcccgatgtcgacatggtgtcg
ttcaccggctcgacgcgcgcgggcaagcgcgtcgccgagctggccgcggccggcgtgaag
cgcgtcgcgctcgaactgggcggcaagtccgcgtcggtgattctcgacgacgcggatttc
gcggccgcggtgaagggtacggtatccgcgtgctatctgaacgcgggccagacgtgctcc
gcgcacacgcggatgctcgtgccggaatcgcgctacgacgaagcgcgcgagctcgcgaag
gcggcggccgaagcatatgtcgcgggcgacccgcgcgatgacgcgacgcggctcggcgcg
ctcgcgtcggcggttcagcaagcgcgcgtgcaggactacatccggcgcggcatcgacgaa
ggcgcggaactcgtcacgggcgggctcggcatgccggagggcctgacgcgcggcttcttc
gtgaagccgaccgtgttcggccgcgtgaagcccgatgcgacgatcgcacaggaggaaatc
ttcggccccgtgctgtcgatcgtcacgtatcgcgacgacgacgacgcggtgcggatcgcg
aacgattcgccgtacggtctcggcggtgcggtgtggtcgggcagcgacgagcacgcgctg
cgcgtcgcgcggcgcattcgcacgggccaggtcgacatcaacggcggtgcctggaacatg
gctgcgccgttcggcggtttcaaacagtcggggatcggccgcgagaacggtgtgtacggg
ctcgaggaatatctggaatacaaatcgatgcagttgcgtccgaaaaagaacgcataa

DBGET integrated database retrieval system