KEGG   Burkholderia oklahomensis C6786: BG90_3436Help
Entry
BG90_3436         CDS       T03861                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
boc  Burkholderia oklahomensis C6786
Brite
KEGG Orthology (KO) [BR:boc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BG90_3436
Enzymes [BR:boc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BG90_3436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AJX32175
LinkDB All DBs
Position
I:complement(3866344..3867405)
Genome map
AA seq 353 aa AA seqDB search
MTAIVCHAPEDYRVERVTKPRAAARELVIRIGACGICASDCKCHSGAKMFWGGPSPWVKA
PVIPGHEFFGYVEELGEGAAEHFGVALGERVIAEQIVPCGKCRYCKSGQYWMCEVHDIFG
FQREVADGGMAEYMRIPPTAIVHKIPLGISLEDAAIIEPLACAIHTVNRGDLQLDDVVVI
AGAGPLGLMMTQVAKLKTPKRLVVIDLVAERLALAREYGADVTIDPTRDDALAIVRDLTG
GYGCDVYIETTGVPAGVTQGMDLIRKLGRFVEFSVFGKDTTVDWSIIGDRKELDVRGAHL
GPYCYPVAIDLLARGLVTSKGIVTHGFSLDEWDEAIRVANSLDSIKVLLKPRR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgatcgtctgccacgctcccgaggactatcgggtcgagcgcgtgacgaagccg
cgcgcggccgcgcgcgagctcgtgatccgcatcggcgcgtgcgggatctgcgcgagcgac
tgcaagtgccattccggcgcgaagatgttctggggcggcccgagcccgtgggtcaaggcg
cccgtgattcccggccacgagttcttcggctacgtcgaggagctgggcgaaggcgcggcc
gagcacttcggcgtcgcgctcggcgagcgcgtgatcgccgagcagatcgtgccgtgcggc
aagtgccgctactgcaagtcgggccagtactggatgtgcgaggtccacgacatcttcggc
ttccagcgcgaggtcgccgacggcgggatggccgaatacatgcggattccgccgaccgcg
atcgtccacaagatcccgctcggcatctcgctcgaggacgcggcgatcatcgagccgctc
gcgtgcgcgatccacacggtcaatcgcggcgacctccagctcgacgacgtcgtcgtgatc
gcgggcgcggggccgctcggcctcatgatgacgcaggtcgcgaagctgaagacgccgaag
cggctcgtcgtgatcgatctcgtcgccgagcggctcgcgctcgcgcgcgaatacggcgcg
gacgtgacgatcgatccgacgcgcgacgacgcgctcgcgatcgtccgcgacctgacgggc
ggctacggctgcgacgtctacatcgagacgaccggcgtgccggcgggcgtcacgcaaggg
atggacctgatccgcaagctcggccgcttcgtcgagttctcggtgttcggcaaggacacg
acggtcgactggtcgatcatcggcgatcgcaaggaactcgacgtgcgcggcgcgcatctc
ggtccatattgctatcctgtcgcgatcgatctgcttgcgcgcgggctcgtcacgtcgaag
ggaatcgtcacgcacggcttctcgctcgacgaatgggacgaggcgatccgggtcgcgaat
tcgctcgactcgatcaaggtgctgctgaagccgcgccgctga

DBGET integrated database retrieval system