KEGG   Burkholderia oklahomensis C6786: BG90_3567Help
Entry
BG90_3567         CDS       T03861                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00020  Citrate cycle (TCA cycle)
boc00310  Lysine degradation
boc00380  Tryptophan metabolism
boc01100  Metabolic pathways
boc01110  Biosynthesis of secondary metabolites
boc01120  Microbial metabolism in diverse environments
boc01130  Biosynthesis of antibiotics
boc01200  Carbon metabolism
Module
boc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
boc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:boc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BG90_3567 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    BG90_3567 (sucB)
   00380 Tryptophan metabolism
    BG90_3567 (sucB)
Enzymes [BR:boc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BG90_3567 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AJX32769
LinkDB All DBs
Position
I:complement(4014037..4015302)
Genome map
AA seq 421 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQLIATIDTEAKAGAAAAAAGAAEVQPAAAPAPAAQPAAAAASSAASASP
AASKLMAEKGLAAGDVAGSGRDGRITKGDVLSAGGAPKAAPAAAPAKAAAKPALPEVKVP
ASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKYKDKF
EKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVVPIL
RNADQLSLAEIEKKIAEFGQKAKDGKLSIDEMTGGTFSISNGGVFGSMLSTPIINPPQSA
ILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPARLLLD
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctctccgaatcggtttcggaagcgaccatg
ctgcagtggaagaagaagcccggcgaagccgtcgcgcaagacgaaatcctgatcgagctc
gagaccgacaaggtcgtcctcgaagtgccggcgcccgccgcgggcgtgctcgcgcaagtg
ctgcagaacgacggtgacacggtcgtcgccgaccagctgatcgcgacgatcgacaccgaa
gcgaaggcgggcgccgccgccgccgcggcaggcgccgccgaagtccagccggccgccgcg
cccgcgcccgccgcgcaacccgccgctgccgctgcgtcgagcgcggcttccgcctcgccc
gccgcgtcgaagctgatggcggagaagggtctcgccgccggcgacgtcgccggctcgggc
cgcgacggccgcatcacgaagggcgacgtgctgtccgcgggcggcgcgccgaaggccgcg
ccggccgccgcgccggcgaaggccgccgcgaagccggcgctgccggaggttaaggtgccg
gcgtcggcgacgacgtggctcaacgaccgtccggaacagcgcgtgccgatgtcgcgtctg
cgtgcgcgcatcgccgagcgtctgctcgagtcgcagcagacgaacgcgatcctgacgacg
ttcaacgaagtgaacatgcagcccgtcatggacctgcgtgcgaagtacaaggacaagttc
gagaaggagcacggcgtgaagctcggcttcatgtcgttcttcgtgaaggccgcggtccac
gcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggcaacgacatcgtctaccac
ggctacttcgacatcggcatcgcggtcggttcgccgcgcggcctcgtcgtgccgatcctg
cgcaacgcggatcagctgagcctcgccgagatcgagaagaagatcgccgaattcggccag
aaggcgaaggacggcaagctgtcgatcgacgaaatgacgggcggtacgttctcgatctcg
aacggcggcgtgttcggctcgatgctgtcgaccccgatcatcaacccgccgcagtcggcc
atcctcggcgtgcatgcgacgaaggagcgcccggtcgtcgagaacggccagatcgtgatc
cgtccgatcaactatctcgcgctgtcgtacgaccaccggatcatcgatggccgcgaagcg
gtgctgtcgctcgtcgcgatgaaggacgcgctcgaagatccggcgcgcctgctgctcgac
ctgtaa

DBGET integrated database retrieval system