KEGG   Burkholderia oklahomensis C6786: BG90_3568Help
Entry
BG90_3568         CDS       T03861                                 

Gene name
sucA
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00020  Citrate cycle (TCA cycle)
boc00310  Lysine degradation
boc00380  Tryptophan metabolism
boc01100  Metabolic pathways
boc01110  Biosynthesis of secondary metabolites
boc01120  Microbial metabolism in diverse environments
boc01130  Biosynthesis of antibiotics
boc01200  Carbon metabolism
Module
boc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
boc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:boc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BG90_3568 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    BG90_3568 (sucA)
   00380 Tryptophan metabolism
    BG90_3568 (sucA)
Enzymes [BR:boc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BG90_3568 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AJX33018
UniProt: A0A1B4AUT6
LinkDB All DBs
Position
I:complement(4015436..4018300)
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYEAYLDNPASVPENWREYFDALQNVPATDGSNASD
VAHNPIVESFAQRAKANAFIPRESGSNLATARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEADLDQTFSASNLYFGFEQASLRDIVKGLRDTYCGTIGAEFMYI
GDPEQKRWWQDRLETIRATPNFSADKKKHILNRLTAAEGLERYLHTKYVGQKRFSLEGGE
SFIASMDEVVQHAGSKGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDADGLQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDSRSTLYCTDVVK
MIEAPVLHVNGDDPEAVVLATQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLVQQGVITAEEGDGFVKAYRKAMDDGHHTVDPVLSNYKSKYAV
DWMPFLNRKWTDAADTAVPLAELKRLGERITTVPENFKVHPLVERVINDRRAMARGDQPL
DWGMGEHLAFASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAE
GQAKFTVIDSVLSEEAVLGFEYGYSTAEPNTLVAWEAQFGDFVNGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSTRIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLVVATPKSLLRHKEAVSDLSELAKGSFQPVLGEVDGGIDAKKVKRVLVCSGRVYY
DLVAHRREAKANDVAIVRIEQLYPFAHKQFEAEMKKFENATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSASIAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcagttccagctgaactcgtatttgttcggcggcaacgcttcg
tatgttgaagaactatacgaagcctatttggataatccggcgtcggtgccggaaaactgg
cgcgaatatttcgacgcactgcagaacgttcccgcgaccgacggttccaacgcgagcgac
gtggcccacaatccgatcgtcgagtcgttcgcgcagcgcgcgaaagccaacgctttcatc
ccgcgcgaaagcggcagcaacctcgctaccgcccgcaagcaagttcacgttcagtcgctc
atcagcgcttatcgcttcctcggctcgcaatgggccaatctcgatcccctgaagcgccgc
gagcgtcccgcgattcccgagctggaacccgcgttctacgatttctccgaagccgacctc
gaccagacgttcagcgcgagcaacctgtatttcggtttcgagcaggcatcgctgcgcgac
atcgtcaagggtctgcgcgacacgtattgcggcacgatcggcgccgagttcatgtacatc
ggcgatccggagcagaagcgctggtggcaggatcgtctcgagacgatccgcgcgacgccg
aatttctcggccgacaagaagaagcacatcctgaaccgcctgacggccgccgaaggcctc
gagcgctacctgcacacgaagtacgtcggccagaagcgcttctcgctcgaaggcggcgag
agcttcatcgcgtcgatggacgaagtcgtccagcacgcgggctcgaagggcgtgcaggaa
atcgtcatcggcatggcgcaccgcggccgtctgaacgtgctcgtgaacacgctcggcaag
atgccggccgatctcttcgccgaattcgaaggcaagcacgtcgacgacctgccggcaggc
gacgtgaagtatcacaagggcttctcgtcggacgtctcgacggaaggcggcccggtccac
ctgtcgctcgcgttcaacccgtcgcacctcgaaatcgtcaacccggtggtcgagggttcc
gcgaaggcgcggatggaccgccgcggcgacgcagacggcctgcaggtgctgcccgtgcag
atccacggcgacgcggcgttcgcgggccagggcgtcgtgatggaaacgctgaacctcgcg
cagacgcgcggctacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggc
ttcacgacgtcggacccgcgcgactcgcgctcgacgctgtactgtaccgacgtcgtcaag
atgatcgaggcgccggtgctgcacgtgaacggcgacgatccggaagcggtcgtgctcgcg
acgcagatcgcgatcgactaccggatgcagttccacaaggatgtcgtgatcgacatcgtc
tgcttccgcaagctcggccacaacgagcaggacacgccggccgtcacgcagccgctgatg
tacaagaagatcgcgcagcacccgggcacccgtgcgctgtatgcggagaagctcgtccag
cagggcgtgatcacggctgaagaaggcgacggcttcgtgaaggcgtaccgcaaggcgatg
gacgacggccatcacacggtcgatccggtgctgtcgaactacaagagcaagtacgcggtc
gactggatgccgttcctgaaccgcaagtggaccgacgcggccgacaccgcggtgccgctc
gccgagctgaagcgcctcggcgagcgcatcacgacggtgcccgagaacttcaaggtccac
ccgctcgtcgagcgcgtgatcaacgaccgtcgcgcgatggcgcgcggcgatcagccgctc
gactggggcatgggcgagcacctcgcgttcgcatcgctcgtcgcgtcgggctacgccgtg
cgactgaccggccaggactcgggccgcggcacgttcacgcaccgtcacgcggtgctgcac
gaccagaaccgcgagcgctggaacgacggcacctacgtgccgctgcagaacatcgccgaa
ggccaggcgaagttcacggtgatcgactcggtgctgtcggaagaggcggtgctgggcttc
gaatacggctactcgaccgccgagccgaacacgctcgtcgcgtgggaagcgcagttcggc
gacttcgtcaacggcgcgcaggtcgtgatcgaccagttcatctcgtcgggcgaagtgaag
tggggccgcgtgtcgggcctgacgatgctgctgccgcacggctacgaaggccagggtccg
gagcactcgtcgactcgcatcgagcgtttcctgcagctctgcgcggatcacaacatgcaa
gtggtgcagccgacgacgccggcacagattttccatctgctgcgccgtcagatgatccgc
ctgttccgcaagccgctcgtcgtggcgacgccgaagtcgctgctgcgccacaaggaggcg
gtgtcggacctgtcggagctggcgaagggttcgttccagccggtgctgggcgaagtcgac
ggcggcatcgacgcgaagaaggtcaagcgcgtgctggtctgctcgggccgcgtgtactac
gacctcgttgcgcatcgccgcgaagcgaaggcgaacgatgtcgcgatcgtccggatcgag
cagctctatccgttcgcgcacaagcagttcgaagcggagatgaagaagttcgagaacgcg
acggaagtggtctgggtgcaggacgagccgcaaaatcaggggccgtggttctacgtcgaa
caccacctgaaggaaggcatgaaggaagggcagaagctcgcgtacagcggccgcccggct
tccgcctcgccggccgtcggctattacgcgaagcactacgagcagcagaaggccctcatc
gaaggcgcattcggccgcttgaagagcgcatcgatcgcgaaataa

DBGET integrated database retrieval system