KEGG   Burkholderia oklahomensis C6786: BG90_5197Help
Entry
BG90_5197         CDS       T03861                                 

Definition
(GenBank) penicillin-binding, 1A family protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00550  Peptidoglycan biosynthesis
boc01100  Metabolic pathways
boc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:boc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BG90_5197
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BG90_5197
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:boc01003]
    BG90_5197
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:boc01011]
    BG90_5197
Enzymes [BR:boc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BG90_5197
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BG90_5197
Glycosyltransferases [BR:boc01003]
 Polysaccharide
  Bacterial polysaccharide
   BG90_5197
Peptidoglycan biosynthesis and degradation proteins [BR:boc01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BG90_5197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AJX35481
LinkDB All DBs
Position
II:complement(1852554..1855046)
Genome map
AA seq 830 aa AA seqDB search
MLKLKHRFFRRASRAASETPSEAGCDAPDGDRRREPSAATRARTGTIRRLLRGSGIVSAA
IASAALLAAYAAIVMYPQLPTIAALTDFQPTVPLRVYTADDVLIAQYGVERRVPLTFDEI
PDVAKHAVLAAEDARFYEHHGIDVVGLVRAALADFVHDSKRQGASTITMQLARNFFLSRD
KTYLRKIYEILLAMRIESQLSKPQILQLYMNQIYLGERSYGFGAAARTYFGKDLADLSIA
QAAMLAGLPKAPSTFNPVGNPERARTRQHYVLRRMYELGYIDDAQYRAALAEPPYTRPVA
SAGAVRADYVGEMVRQTMVAQYGEAAYERGFRVWTTVRAADQNGAYAAVRRGVAAYDRRH
RYEGPEAVLPMPSAALDAPARRRALMRALLDRPAVPGLTAAVVVSAGARDVTVVTLDGRT
VTLGGPALDFARSRTPSRSLAAAGLRPGAVVRIGTDADDRPMIDELPSVEAALVSVDPES
GAIRALVGGVDEARNPFNHVTQAWRQPGSSFKPFVYSAALEKGFAPATTVDDAPFEAAAS
GDAPPWRPKEVGPLLGPISLREALTKSKNLAAVRILDAIGPDYARTYAIDRFGFSADKLV
ANLPMALGAGSVTPLQMAAAYAVFANGGYRVQPYLVARIVDGRGRTVFDAHPPTADDGAP
RVIPAANSYIMTSLLESVAQHGTASALGALRRPDIAAKTGSTNGYRDGWLAGYQHSLVAV
AWMGFDTSRTLGAGEWGSHTALPIWLDYMRGAMRHVPVYEAAAPGDVAVVDGELYEAAHA
PGNGFVATVGDDRSKDASARAMGASASASASTSTSANASATVPASDAPHA
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaactcaagcatcgcttcttccgccgcgcatcgcgcgcggcatccgaaaccccg
agcgaagccgggtgcgacgctcccgacggcgatcgccgacgcgagccgagcgccgcgacg
cgcgcgcggaccggcacgatccgccgtctgctgcgcggaagcgggatcgtgtccgcggcg
atcgcatcggccgcgctgctcgccgcctatgccgcgatcgtgatgtacccgcaattgccg
acgatcgccgcgctgacggattttcagccgacggtgccgctcagggtctacacggcggac
gacgtgctgatcgcgcagtacggcgtcgaacgccgggtgccgctgacgttcgacgagatc
ccggacgtcgcgaagcacgcggtgctcgccgcggaagacgcccgcttctacgagcaccac
ggcatcgacgtcgtcggtctcgtccgcgcggcgctcgcggactttgtccacgacagcaag
cgacagggcgcgagcacgatcacgatgcagctcgcccgcaacttcttcctgtcccgcgac
aagacctatctgcggaaaatctacgagatcctgctcgcgatgcgcatcgaatcgcagctg
tcgaagccgcagatcctgcagctctacatgaaccagatctacctcggcgagcgctcgtac
ggcttcggcgcggcggcgcggacttatttcggcaaggatctcgccgacctgtcgatcgcg
caggccgccatgctcgccggattgccaaaagcgccgtcgaccttcaatccggtcgggaat
cccgagcgcgcgcgcacgcgccagcactacgtgctgcggcggatgtacgagctcggctac
atcgacgacgcgcaatatcgcgcggcgctcgcggagccgccgtacacgcggcccgtggcg
agcgccggcgcggtccgcgccgactatgtcggcgaaatggtgcggcagacgatggtcgcg
caatacggcgaagccgcatacgaacgcggcttccgggtatggacgaccgtgcgcgcggcc
gatcagaacggcgcgtacgcggccgtgcgccggggcgtcgccgcctacgatcgccggcat
cgctatgaagggccggaagccgtgctgccgatgccgtccgccgcactcgacgcgcccgcg
cgccgccgcgccctgatgcgcgcgctgctggaccggccggccgtcccgggcctgacggcc
gccgtcgtcgtgtcggccggcgcgcgcgacgtgaccgtcgtcacgctcgacggccgcacg
gtgacgctcggcgggccggcgctcgatttcgcccgctcgcgcacgccgtcgcgctcgctg
gcggcggccggactgcggcccggcgcggtcgtgcgaatcggcacggacgcagacgatcgg
ccgatgatcgacgagctgccttcggtcgaggccgcgctcgtctcggtggatccggagagc
ggcgcgatccgcgcgctcgtcggcggcgtcgacgaagcgcgcaatccgttcaaccacgtg
acgcaggcgtggcgccagcccggctcgtcattcaagccgttcgtctactccgccgcgctc
gaaaaaggcttcgcgccggcgacgacggtcgacgatgcgccgttcgaagcggccgcgagc
ggcgacgcgcctccatggcggccgaaggaggtcggtccgctgctcggtccgatctcgctg
cgtgaagcgctgacgaagtcgaagaacctggccgcggtccggatactcgacgcgatcggc
cccgactacgcgaggacgtacgcgatcgaccgcttcggcttcagcgccgacaagctcgtc
gccaacctgccgatggcgctcggcgcgggctcggtcacgccgctgcagatggccgcggct
tacgcggtcttcgcaaacggcggctatcgcgtgcagccgtacctcgtcgcgaggatcgtc
gacggacgcggccgcaccgtgttcgacgcgcacccgccgacggcggacgacggcgcgccg
cgcgtgattcccgccgcgaacagctacatcatgacgagcctgctcgagtccgtcgcgcag
cacggcaccgcgtccgcgctcggcgcgctgcgccgccccgacatcgcggcgaagacggga
tcgacgaacggctatcgcgacggctggctcgccggctatcagcattcgctcgtcgccgtc
gcgtggatgggattcgacacgtcgcgcacgctcggcgcgggcgaatgggggtcgcatacc
gcgctgccgatctggctcgactacatgcgcggcgcgatgcggcacgtgcccgtctacgaa
gcggcggcgcccggcgacgtcgcggtcgtcgacggcgagttgtacgaagccgcgcacgcg
ccgggcaacggcttcgtggcgaccgtgggcgacgatcgcagcaaggacgcgagcgcccgg
gcgatgggcgcatcggcgagcgcgagcgcgagcacgagcacgagcgcgaatgcgagcgcg
accgtgccggcatccgacgcaccgcacgcctga

DBGET integrated database retrieval system