KEGG   Burkholderia oklahomensis C6786: BG90_5199Help
Entry
BG90_5199         CDS       T03861                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase family protein
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00550  Peptidoglycan biosynthesis
boc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BG90_5199
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:boc01002]
    BG90_5199
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:boc01011]
    BG90_5199
Enzymes [BR:boc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BG90_5199
Peptidases [BR:boc01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BG90_5199
Peptidoglycan biosynthesis and degradation proteins [BR:boc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BG90_5199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AJX35504
LinkDB All DBs
Position
II:complement(1857170..1858156)
Genome map
AA seq 328 aa AA seqDB search
MTSEQQSITITHKPEARLSAMPRRILGAMLVVATSIAANGAQASPAPQIQAVSWLVVDAD
SGKTLAEHNVSARREPASLTKLMTAYLALDALKQGTLRWDEKVEIAADDIASVGNDEARM
YLAPGQRVQVRDLVRGLIVASANDAALVLAKRIGGSPAGFAKRMNDAAQRLGMRDSHFVS
PSGITTPDHYSTAHDLSILARHLNQDFPEFYTFSSQQHFEYGKFAKTNKNRLLRADPTVD
GMKTGHTNAAGWCMVVTAKRGVAGSHAKHRVIAVLLGEPTEKQRLADARRLLDWGFASLG
GEHPAANVARRADPQAGERRSAESARML
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcgagcaacaatcgatcaccatcacgcacaaacccgaagcgcgtctgtcggcc
atgcctcgccgcatcctgggcgccatgctggtcgtcgcgacgtccatcgcggcgaacggc
gctcaggcaagccccgcgccgcagattcaggcggtctcgtggctcgtcgtcgatgccgac
tccggcaagacgctcgccgagcacaatgtgagcgcgcgccgcgagccggcgtcgctgacc
aagctgatgaccgcgtacctcgcgctcgatgcgctgaagcaagggacgctgcgctgggac
gagaaggtcgagatcgccgccgacgacatcgcttccgtcggcaacgacgaagcgcggatg
tacctggcgccgggccagcgcgttcaggtgcgcgacctcgtgcgcggcttgatcgtcgcg
tccgccaacgatgcggcgctcgtgctcgcgaagcggatcggcggcagccccgccggcttc
gcgaagcggatgaacgacgcggcgcagcggctcggcatgcgcgattcgcacttcgtgtcg
ccgtccgggatcaccacgcccgatcattattcgaccgcgcacgacctgtcgattctcgcc
cggcatctgaaccaggattttccggagttctacacgttctcgtcgcagcagcatttcgag
tacggaaaattcgcgaagacgaacaagaatcgcctgctgcgcgccgatccgaccgtcgac
ggcatgaagacgggccatacgaatgcggccggctggtgcatggtcgtcaccgcgaagcgc
ggcgtcgccggctcgcacgcgaagcatcgcgtgatcgccgtgctgctcggcgagccgacg
gaaaagcagcggctcgccgacgcgaggcgactcctcgactggggcttcgcgtcgctcggc
ggcgagcatccggccgcgaacgtcgcgcgccgagccgatccgcaggcgggcgagcgccgc
tcggcggaatcggcgcgcatgctctga

DBGET integrated database retrieval system