KEGG   Burkholderia oklahomensis C6786: BG90_5203Help
Entry
BG90_5203         CDS       T03861                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00040  Pentose and glucuronate interconversions
boc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:boc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BG90_5203
Enzymes [BR:boc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     BG90_5203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AJX35695
LinkDB All DBs
Position
II:complement(1862599..1863633)
Genome map
AA seq 344 aa AA seqDB search
MKALVLEQARELALRDIDLPLDVGPADVKIRVHTVGVCGSDVHYYTHGGIGPFRVDAPMV
LGHEASGTVVEIGRDVTSLRVGDRVCMEPGVPRLDSKATLHGLYNLDPSVRFWATPPVHG
CLTPYVVHPAPFTYRLPENVSFAEGAIVEPLSIGLQAAKKAAMKPGDIAVVIGAGTIGAM
TALAALAGGAARVFLADVVKEKLSLFASNRAVTTVDVSTQPLADAVMHATDGWGADVVFE
ASGNAKAYAGVIDLLCPNGCLVLIGMPLDPVPLDVVALQAKEARIESVFRYANVFPRALA
LIASGAIDVKPFISRTFPFSDSLRAFEEAASGHPHDVKIQIEMD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccctcgtactcgaacaggcgcgcgagctcgcgctgcgcgacatcgacctgccg
ctcgacgtcggcccggccgacgtcaagatccgggtccataccgtcggcgtctgcggcagc
gacgtccactactacacgcacggcggcatcggcccgttcagggtcgacgcgccgatggtg
ctcggccacgaagcgtcgggcacggtcgtcgagatcgggcgcgacgtcacgagcctgcgc
gtcggcgatcgcgtctgcatggagcccggcgttccgcgcctcgattcgaaggcgacgctg
cacggcctctacaacctcgatccgtcggtgcgcttctgggcgacgccgcccgtgcacggc
tgcctcacgccctacgtcgtgcatccggcgccgttcacgtaccggctgccggagaacgtg
tcgttcgccgaaggcgcgatcgtcgagccgctgtcgatcgggctgcaggccgcgaagaag
gcggcgatgaagccgggcgacatcgcggtcgtgatcggcgcggggacgatcggcgcgatg
acggcgctcgccgcgctcgcgggcggcgccgcgcgcgtgttcctcgccgacgtcgtcaag
gagaagctgtcgctgttcgcgtcgaaccgcgcggtgacgacggtcgacgtgagcacgcag
ccgctcgccgacgcggtcatgcacgcgaccgacggctggggcgcggacgtcgtgttcgaa
gcgagcggcaacgcgaaggcctatgcgggcgtcatcgacctgctgtgcccgaacggctgc
ctcgtgctgatcgggatgccgctcgatccggtgccgctcgacgtcgtcgcgttgcaggcg
aaggaagcgcggatcgagtcggtgtttcgctatgcgaacgtcttcccgcgcgcgctcgcg
ctgatcgcgtccggcgcgatcgacgtgaagccgttcatttcgcgcacgttcccgttctcg
gacagcctgcgcgcattcgaggaagcggcgagcgggcatccgcacgacgtgaagattcag
atcgaaatggattga

DBGET integrated database retrieval system