KEGG   Burkholderia oklahomensis C6786: BG90_578Help
Entry
BG90_578          CDS       T03861                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00620  Pyruvate metabolism
boc00680  Methane metabolism
boc00710  Carbon fixation in photosynthetic organisms
boc01100  Metabolic pathways
boc01120  Microbial metabolism in diverse environments
boc01200  Carbon metabolism
Module
boc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:boc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BG90_578
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BG90_578
   00680 Methane metabolism
    BG90_578
Enzymes [BR:boc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BG90_578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 FAD-oxidase_C
Motif
Other DBs
NCBI-ProteinID: AJX32174
LinkDB All DBs
Position
I:630500..633358
Genome map
AA seq 952 aa AA seqDB search
MNAARPASAAPAKPHGRTREDKDRPLFEDIRYLGRLLGDVVREQEGDAVFHVVETIRQTA
VKFRREDDSAAAQTLEKMLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAG
SAPQAGTVAYALDKLKEAGDASSKVIKRFFEGALIVPVLTAHPTEVQRKSILDAQHDIAH
LLAERDQPLTAREFAHNEALLRARVTTLWQTRMLRDARLTVADEIENALSYYRATFLDEL
PALYADIEEALAEHGLPARVPAFFQMGSWIGGDRDGNPNVTAATLDEAINRQAAVIFEHY
LEQVHKLGAELSVSNLLVGANDALKALAAASPDQSPHRVDEPYRRALIGVYTRLAASARV
RLGEGAVPVRSAGRGAAPVRATPYADAEEFAADLRVLTDSLALHHGESLATPRLAPLMRA
AEVFGFHLASIDLRQSSDIHEAVIAELLARGGVEPDYAALAEADKLRVLLAALADPRPLR
SPYLDYSDLAKSELGVLERAHAIRAQFGPRAVRNYIISHTETVSDLVEVLLLQKETGLFE
GTLGTPHANARNGLMAIPLFETIADLRNAPDIMREFFALPGVGELVAHQGHEQEVMLGYS
DSNKDGGFLTSNWELYRAELALVDLFSERGIKLRLFHGRGGTVGRGGGPTYQAILSQPPG
TVNGQIRLTEQGEVIASKFANPEIGRRNLETVVAATLEATLLPHRNAPKQLPAFEAAMQA
LSDAAMASYRALVYETPGFTDYFFSSTPITEIAELNIGSRPASRKLQDPKNRKIEDLRAI
PWGFSWGQCRLLLTGWYGFGSAVAAFLDGTKDAAERAKRVALLKKMNKTWPFFAHLLSNM
DMVLAKTDLAVASRYAQLVADKKLRKHVFERIVSEWHRTSDALAEITGSDARLAANPLLA
RSIKNRFPYLDPLNHLQVELIKRHRSGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcggcccggccggcgagcgccgcgccggccaaaccgcacggccgcacgcgcgag
gacaaggaccgcccgctcttcgaagacatccgctatctcggccgcctgctcggcgacgtc
gtccgcgagcaggaaggcgacgccgtgttccacgtcgtcgagacgatccgccagaccgcc
gtcaagttccgccgcgaggacgacagcgccgccgcgcagacgctcgagaagatgctgcgc
aagctcacgcccgagcagacggtgagcgtcgtgcgcgcgttcagctatttctcgcatctc
gcgaacatcgccgaggaccgccatcacaaccgccgccgccggatccacgcgctcgcgggc
tccgcgccgcaggcgggcaccgtcgcgtacgcgctcgacaagctgaaggaagcgggcgac
gcgtcgtcgaaggtgatcaagcggttcttcgaaggcgcgctcatcgtgcccgtgctgacc
gcgcacccgaccgaggtgcagcgcaagagcattctcgacgcgcagcacgacatcgcgcat
ctgctggccgagcgcgaccagccgctgaccgcgcgcgagttcgcgcacaacgaggcgctc
ttgcgcgcgcgcgtgacgacgctctggcagacccggatgctgcgcgacgcgcgcttgacg
gtcgccgacgagatcgagaacgcgctgtcgtactaccgcgcgacgttcctcgacgagctg
cccgcgctctacgcggacatcgaggaagcgctcgccgagcacggcctgcccgcgcgcgtg
cccgcgttcttccagatgggaagctggatcggcggcgaccgcgacggcaacccgaacgtc
acggccgcgacgctcgacgaagcgatcaaccgccaggccgcggtgatcttcgagcattac
ctcgagcaggtgcacaagctcggcgccgagctctccgtgtcgaacctgctcgtcggggcg
aacgacgcgctgaaggcgctcgcggccgcgtcgccggaccagtcgccgcaccgcgtcgac
gagccgtatcggcgcgcgctgatcggcgtctacacgcggcttgcggcgagcgcgcgcgtg
cggctcggcgaaggcgcggtgcccgtgcgcagcgcgggccgcggcgccgcgcccgtgcgc
gcgacgccgtatgcggacgccgaggaattcgccgccgatctgcgcgtgctgacggattcg
ctcgcgctgcatcacggcgaatcgctcgcgacgccgcgcctcgcgccgctcatgcgcgcg
gccgaggtgttcggcttccatctcgcgagcatcgacttgcggcaaagctcggacatccac
gaagcggtgatcgccgagctgctcgcgcgcggcggcgtcgagcccgactacgcggcgctc
gccgaagcggacaagctgcgcgtgctgctcgcggcgctcgccgatccgcggccgctgcgc
tcgccgtatctcgactactcggatctcgcgaaaagcgagctcggcgtgctcgagcgcgcg
cacgcgatccgcgcgcagttcggtccgcgcgcggtgcgcaactacatcatctcgcacacc
gagacggtgagcgatctcgtcgaggtgctgctgctgcagaaggaaacaggcctcttcgaa
ggcacgctcggcacgccgcacgcgaacgcgcgcaacggcctgatggcgatcccgctcttc
gagacgatcgccgacctgcgcaacgcgcccgacatcatgcgcgagttcttcgcgctgccg
ggcgtcggcgagctggtcgcgcaccagggccacgagcaggaagtgatgctcggctattcg
gacagcaacaaggacggcggctttctcacgtcgaactgggagctctatcgtgcggaactg
gcgctcgtcgatctgttcagcgagcgcgggatcaagctgcgcctcttccacggccgcggc
ggcacggtcggccgcggcggcggcccgacctaccaggcgatcctgtcgcagccgcccggc
acggtgaacggccagatccgcctgaccgagcagggcgaagtgatcgcgagcaagttcgcg
aacccggagatcggccggcgcaacctcgaaacggtcgtcgccgcgacgctcgaggcgacg
ctcctgccgcaccgcaacgcgccgaagcagttgcccgcgttcgaggcggcgatgcaggcg
ctgtccgacgccgcgatggcctcgtaccgcgcgcttgtctacgagacgcccggcttcacc
gactacttcttctcgtcgacgccgatcaccgagatcgccgagctgaacatcggcagccgg
ccggcgtcgcgcaagctgcaggatccgaagaaccgcaagatcgaggacctgcgcgcgatt
ccgtggggcttctcgtggggccagtgccggctgctgctgacgggctggtacggcttcggc
agcgcggtcgccgcatttctcgacggcacgaaggacgccgccgagcgcgcgaagcgggtc
gcgctgctgaagaagatgaacaagacctggccgttcttcgcgcacctgctgtcgaacatg
gacatggtgctcgcgaagacggatctcgcggttgcgtcgcgctacgcgcagctcgtcgcc
gacaagaagctgcgcaagcacgtgttcgagcggatcgtctccgaatggcaccgcacgtcg
gacgcgctcgccgagatcaccggcagcgacgcgcggctcgccgcgaatccgctcctcgcg
cgctcgatcaagaaccgctttccgtatctcgatccgctcaaccacctgcaggtcgagctg
atcaagcggcaccgctcgggcgacacgaacgcgcgcctgcggcgcgggatccatttgacg
atcaacgggatcgcggccggcctgcgcaatacgggctga

DBGET integrated database retrieval system