KEGG   Burkholderia oklahomensis C6786: BG90_5888Help
Entry
BG90_5888         CDS       T03861                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00440  Phosphonate and phosphinate metabolism
boc01100  Metabolic pathways
boc01120  Microbial metabolism in diverse environments
boc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:boc00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BG90_5888 (aepX)
Enzymes [BR:boc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BG90_5888 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase DHDPS ThiG ComA
Motif
Other DBs
NCBI-ProteinID: AJX34853
UniProt: A0A1B4B4E3
LinkDB All DBs
Position
II:2664926..2665837
Genome map
AA seq 303 aa AA seqDB search
MPIRELISQPITNEQRRRTFKEKLASGHALRFIESHSPISAMISEKVYVADGVSQSEFDG
FWSSSLTDSTLRGRPDIEILDIASRLSNVQHIFDVTTKPLIIDGDTGGKPEHFALNVQSL
ERSGVSAVIIEDKTGLKKNSLLGNDVIQHQESIDEFCEKIRVGKAAQITDDFQIIARVES
LILDKGMQDALERAAAYCEAGADGIMIHSRKKDADEVIEFAQRFRELGCHAYLVCVPTSF
NAISFSELARHFSVVIYANHLLRAAYPAMLAVAEGILAHGRTLEIEERCLPVNEILKLIP
GTA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgccgataagagaactaataagccagccgattaccaacgaacaacgccgtcgaacgttc
aaggaaaagctggcgtcaggccacgcactgcgcttcatcgaaagccacagtccgatttcc
gcaatgatcagtgaaaaagtttatgtggcggacggggtctcgcaatccgagttcgacggc
ttctggtccagctcgctgaccgattcgacgctgcgcggccggcccgacatcgagatcctc
gacatcgcgagccggctgtcgaacgtccagcacattttcgacgtcacgaccaagccgctc
atcatcgatggcgacacgggcggcaagcccgagcatttcgcgttgaacgtccaatcgctg
gaacgatccggcgtatcggccgtgattatcgaagataaaacagggttgaagaaaaattcg
ctgctcggcaacgatgtgattcagcaccaggaatcgatcgacgaattctgcgagaaaatc
cgcgtcggcaaggcggcgcagatcaccgacgattttcagatcatcgcccgcgtcgaaagc
ctgattctcgacaagggaatgcaggatgcgctcgaacgtgcggccgcctactgcgaagcc
ggcgccgacggcatcatgatccacagccgcaagaaagacgcggacgaagtcatcgaattc
gcgcagcggtttcgcgaactcggctgccacgcgtatctcgtctgcgtgccgacgagcttc
aacgcgatttcgttcagcgagctcgcgcgtcatttcagcgtcgtcatctacgcgaatcac
ctgctgcgcgccgcctatccggcgatgctcgcggtcgccgaaggcatcctggcgcatggc
cggacgctcgaaatcgaggagcgctgcctgcccgtcaacgagatcctgaagctcatccca
ggaaccgcatga

DBGET integrated database retrieval system