KEGG   Burkholderia oklahomensis C6786: BG90_6000Help
Entry
BG90_6000         CDS       T03861                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
boc  Burkholderia oklahomensis C6786
Brite
KEGG Orthology (KO) [BR:boc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BG90_6000 (ahpF)
Enzymes [BR:boc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BG90_6000 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA Glutaredoxin FAD_binding_2 DAO FAD_oxidored Thi4 HI0933_like FAD_binding_3 NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AJX35089
LinkDB All DBs
Position
II:2808818..2810422
Genome map
AA seq 534 aa AA seqDB search
MLDANLKTQLKSYLERITRPVELVASLDDGDKSRELRALLDEIASLSPQVVVERRDDDER
SPSFSVGERGKATGIRFAGMPMGHEFTSLVLALLQAGGHPLKLDDAVIEQIRQLDGDYAF
ETYISLTCQNCPEVVQALNVMALVNPRIRHVMIDGALFQDEVEARRIMAVPTIFLNGEAF
AQGRSSVKEILAKLDSGASRRAADALATKPVFDMLIVGGGPAGAAAAIYAARKGIATGVV
AERFGGQVLDTMAIENFVSVKETEGPKFATALEQHVKQYEVDVIDVQRADKLVPGRVHEI
HLASGAVLKAKTIVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGGN
SGVEAAIDLAGIVREVTLIEYGAQLRADEVLQRKLRSLANVTVITQARTTELTGDGARLN
GLVYEDMRTGETKRVELEGVFVQIGLVPNTEWLKGTLELSKHGEIVVDARGATSAPGVFA
AGDVTTVPYKQIVIAVGEGAKASLGAFDYLIRSEADAAPAPAAETARSDEMIAA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagactcagttgaaatcgtacctcgaacggatcacccgcccg
gtcgagctcgtcgcgtcgctcgacgacggcgacaaatcgcgcgagctgcgcgcgctgctc
gacgagatcgcatcgctgtcgccgcaagtcgtcgtcgagcgccgcgacgacgacgagcgc
tcgccgtcgttctccgtcggcgagcggggcaaggcgaccggcattcgtttcgccggcatg
ccgatgggccatgaattcacgtcgctcgtgctcgcgctgctgcaagcaggcgggcatccg
ctcaagctcgacgacgctgtgatcgagcaaattcgccagctcgacggcgactacgcattc
gagacgtacatttcgctgacctgccagaactgcccggaagtcgtgcaggcgctcaacgtg
atggcgctcgtcaacccgcgcatccgtcacgtgatgatcgacggcgcgctgttccaggac
gaggtcgaagcgcgccggatcatggccgtgccgacgatcttcctgaacggcgaagccttc
gcccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgatagcggcgcgagccgg
cgcgcggcggacgcgctcgcgacgaagccggtgttcgacatgctgatcgtcggcggcggc
cctgcgggtgcggcggctgcgatctacgcggcgcgcaagggcatcgcgacgggcgtcgtc
gccgagcgcttcggcgggcaggtgctcgacacgatggccatcgagaacttcgtgtcggtc
aaggagaccgaaggtccgaagttcgcgaccgcgctcgaacaacacgtgaagcagtacgaa
gtcgatgtgatcgacgtgcagcgcgccgacaagctcgtccccggccgtgtccacgagatc
catctcgcgagcggcgcggtgctgaaggcgaagaccatcgtgctcgcgaccggcgcgcgc
tggcgcgaaatcggcgtgcccggcgagcgcgagtatcgcaatcgcggcgtcgcgtactgc
ccgcattgcgacggcccgctcttcaagggcaagcgcgtcgcggtggtcggcggcggcaac
tcgggcgtcgaagcggcgatcgatctcgccggcatcgtccgcgaggtgacgctgatcgaa
tacggcgcgcaactgcgcgcggacgaagtgctgcagcgcaagctgcgcagtctcgcgaac
gtgacggtgatcacgcaggcacgcacgaccgaactcacgggcgacggcgcaaggctgaac
gggctcgtctacgaagacatgcgcaccggcgagacgaagcgcgtcgagctggaaggcgtg
ttcgtccagatcggactcgtgccgaacaccgaatggctgaagggaacgctcgagctgtcg
aagcacggcgagatcgtcgtcgatgcgcgcggcgcgacgtcggcgccgggcgtgttcgca
gccggcgacgtgacgaccgtgccgtacaagcagatcgtgatcgcggtcggtgaaggcgcg
aaggcttcgctcggcgcgttcgattacctgatccgcagcgaagcggatgcggcgccggcc
ccggccgccgaaaccgcgcgaagcgacgaaatgatcgccgcctga

DBGET integrated database retrieval system