KEGG   Burkholderia oklahomensis C6786: BG90_738Help
Entry
BG90_738          CDS       T03861                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
boc  Burkholderia oklahomensis C6786
Pathway
boc00020  Citrate cycle (TCA cycle)
boc00480  Glutathione metabolism
boc01100  Metabolic pathways
boc01110  Biosynthesis of secondary metabolites
boc01120  Microbial metabolism in diverse environments
boc01130  Biosynthesis of antibiotics
boc01200  Carbon metabolism
boc01210  2-Oxocarboxylic acid metabolism
boc01230  Biosynthesis of amino acids
Module
boc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
boc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:boc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BG90_738 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BG90_738 (icd)
Enzymes [BR:boc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BG90_738 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AJX32740
LinkDB All DBs
Position
I:complement(804173..805432)
Genome map
AA seq 419 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVEKAYA
GKKKIHWMEIYAGEKATKVYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQDLDLYVCLRPVQYFKGVPSPVRAPEKTDMVIFRENSEDIYAGIEWAAESEQAKKVIKF
LQEEMGVKKIRFPETSGIGIKPVSKEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GAFRDYGYALAQKEFGAELIDGGPWMKFKNPKTGNEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADVIIAAMEKSILQKRVTYDFARLMEGATQVSCSGFGQVLIENMQ
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggaaggcggtgacaagatcaccgtcaacaaggat
ttctcgctcaacgtttccgatcagccgatcattccttacatcgaaggcgacggcacgggc
ttcgacatcacgccggtgatgatcaaggtcgtcgacgcggcggtcgagaaggcgtacgcc
ggcaagaagaagatccactggatggagatctacgccggcgagaaggcgacgaaggtctac
ggtccggacgtatggctgccggaagagacgctgcaggtgctgaaggaatacgtcgtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcatccgctcgctgaacgtcgcgctg
cgccaggatctcgacctgtacgtctgcctgcgccccgtgcagtacttcaagggcgtgccg
tcgccggtgcgcgcgccggaaaagaccgacatggtgatcttccgcgagaattcggaagac
atctacgccggcatcgaatgggcggccgagtccgagcaggcgaagaaggtcatcaagttc
ctgcaggaagagatgggcgtgaagaagatccgcttcccggaaacgtcgggcatcggcatc
aagcccgtgtcgaaggaaggcaccgagcgtctcgtgcgcaaggcgatccagtacgcgatc
gacaacgaccgcaagtcggtcacgctcgtccacaagggcaacatcatgaagttcacggaa
ggcgcgttccgtgactacggctatgcgctcgcgcagaaggagttcggcgccgagctgatc
gacggcggcccgtggatgaagttcaagaacccgaagacgggcaacgagatcgtcatcaag
gattcgatcgccgacgcgttcctgcagcagatcctgctgcgtccggccgagtacgacgtg
atcgcgacgctgaacctgaacggcgactacatctccgacgcgctcgccgcgcaagtcggc
ggcatcggcatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaagcgacg
cacggcacggcgccgaagtacgcgggcaaggattacgtgaacccgggctcggaaatcctg
tcggccgaaatgatgctgcgccacctcggctggaccgaagcggcagacgtcatcatcgcc
gcgatggaaaagtcgatcctgcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaagtgtcgtgctcgggcttcggccaggtgctgatcgaaaacatgcagtaa

DBGET integrated database retrieval system