KEGG   Brassica oleracea (wild cabbage): 106294690Help
Entry
106294690         CDS       T04124                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00564  Glycerophospholipid metabolism
boe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    106294690
Enzymes [BR:boe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     106294690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 GIDA Pyr_redox_2 HI0933_like Pyr_redox 3HCDH_N Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 106294690
NCBI-ProteinID: XP_013585763
UniProt: A0A0D3CLG6
LinkDB All DBs
Position
C5
AA seq 631 aa AA seqDB search
MSPASSLRRLAVGAAVIAAASGGGAVYLSPSVASSDRGGGPVLDSLRRRIGDPNASVPSR
SAQESVLIGASASNPLDVLVIGGGATGSGVALDAATRGLRVGLVEREDFSSGTSSRSTKL
IHGGVRYLEKAVFNLDYGQLKLVFHALEERKQLIENAPHLCHALPCMTPCFDWFEVVYFW
MGLKMYDLVAGPRLLHLSRYYSAQESAELFPTLARKGKDRSLRGTVVYYDGQMNDSRLNV
GLACTAALAGAAVLNHAEVVSLITDEATKRIVGARVRNNLTGKEFESYAKVVVNAAGPFC
DSIRKMVDEDTKPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGT
TDSNTSITPLPEPHEDEIQFILDAISDYLNIKVRRTDVLSAWSGIRPLAMDPTAKSTESI
SRDHVVFEENPGLVTITGGKWTTYRSMAEDAVDATIKSGKLSPTNECVTQKLQILGSHGW
EPSSFTALAQQYVRMKKTYGGKVVPGAMDTAAAKHLSHAYGSMADRVAIIAQEEGLGKRL
AHGHPFLEAEVAYCARHEYCESAVDFIARRCRIAFLDTDAAARALQRVVEILASEHKWDK
SREKQELQKAKEFLETFKSSKNAQFHDGKHN
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccagcctcctccctccgccgcttagccgtcggagccgccgtaatcgccgccgca
tccggcggtggcgctgtctacctctccccgtcggtcgcctccagcgacagaggcggtggt
ccggttctggattcgctgaggcgcaggatcggcgatccaaacgcttccgtgccttctcga
tccgctcaagagtctgttctgatcggagccagcgcctctaatcctctcgatgtcctcgtc
attggcggtggagccactggctctggagtcgcgctcgacgctgcgacgcgtggcctccgt
gttggcctggtggagcgtgaggatttctcctcggggacgtcttctcgttcgacgaagctt
atccatggaggtgttcggtacttggagaaagctgtgttcaatcttgactacggacagctg
aagcttgtattccacgcgctcgaggagcgcaaacagctcatcgagaacgcgccgcatctc
tgccacgctctcccctgtatgacaccttgtttcgactggttcgaagttgtctacttctgg
atgggactgaagatgtacgacttggtcgcaggaccgcggttactgcatctctctagatac
tactctgcgcaagagtctgctgagctcttcccaactcttgcaaggaaagggaaagacagg
agcttgagaggcactgttgtgtattacgacgggcaaatgaatgattcacgtctgaatgtg
gggttggcttgtactgctgcgttggctggtgctgctgttctcaaccatgctgaggttgtg
tcgcttattacagatgaggctactaagagaatagttggtgccagagttcgtaacaatctc
acaggcaaagaatttgagagctatgcgaaagtggttgttaatgcggctggaccgttctgt
gactccattaggaagatggttgatgaagatacaaaaccgatgatatgtccaagcagcggt
gtacacatcgtgctccctgattactattctccagaagggatggggttgatagtccctaaa
actaaggatggtcgcgttgtgttcatgttaccgtggttgggaagaacagtagcaggtact
acagactctaacacatcgatcactccgcttccagaacctcatgaggatgagattcagttt
attctggatgcaatcagtgactatcttaacattaaggttcgacgtactgatgttctctcg
gcttggagtggtatccgaccattggcaatggatccaacagcaaagagcacagagagtatc
tccagagaccatgttgtcttcgaggaaaaccctggtctggtcacaatcactggtggaaaa
tggactacttatcgaagtatggcggaagatgcggtggatgcaacaatcaaatcgggaaag
ctgagtccaaccaatgaatgtgtaacgcagaagctacagattcttggttctcatggatgg
gaaccatcttctttcacagctcttgcgcagcaatacgtgcgcatgaagaaaacatatggt
ggtaaagtggttcctggagcaatggacacagctgcggctaagcatttgtctcatgcctat
ggttcaatggctgaccgagtcgccataatagctcaggaggaaggtttggggaaacggttg
gcacatggacatccgtttctggaagcagaggttgcttactgtgcaaggcacgagtactgc
gagtcagcggttgatttcatagcaaggagatgtagaatagcgttcttggacacagacgca
gcagcgagggcgttgcagcgtgtggtggagattctagcgagtgaacacaagtgggacaag
tcgagggagaagcaggagttgcaaaaggctaaagagtttcttgaaactttcaagtcttcc
aaaaacgcacagtttcacgacggcaaacacaactaa

DBGET integrated database retrieval system