KEGG   Brassica oleracea (wild cabbage): 106294774Help
Entry
106294774         CDS       T04124                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK1/AtPK6
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
boe  Brassica oleracea (wild cabbage)
Brite
KEGG Orthology (KO) [BR:boe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:boe01001]
    106294774
Enzymes [BR:boe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106294774
Protein kinases [BR:boe01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   106294774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal FTA2 Pkinase_C Kdo APH RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 106294774
NCBI-ProteinID: XP_013585880
LinkDB All DBs
Position
C5
AA seq 460 aa AA seqDB search
MVSSHRPVPNKTRKQQYLSLSPSDSVLKDDDVELDFSDVFGPLPEEAGDVAFDEPAVIYT
RSHSLVGPSSIGSHSFKLSKLTLRETEDSVDLVECLENEFSGGDDVDSERSPEWELVVKV
PGVVGLDDFEVMKVVGKGAFGKVYQVRMKETSEIYAMKVMRKDKIMEKNHAEYMKAERDI
LTKIDHPFIVQLKYSFQTKYRLYLVLDFINGGHLFFQLYHQGLFREDLARVYTAEIISAV
SHLHEKGIMHRDLKPENILMDVDGHVMLTDFGLAKEFEENTRSNSMCGTTEYMAPEIVRG
KGHDKAADWWSVGILLYEMLTGKPPFMGSRGKIEQKIIKDKIKLPQFLSSEAHALLKGLL
QKEPERRLGSGPSGAEEIKGHKWFKGLNWKKLEAREVKPSFKPEISGRQCIANFDKCWTE
MSVLDSPANSPSSDPKVNPFTNFTYVRPPPSFLQQSTTTL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggtttcatctcaccgtcctgtccccaacaaaacccgcaaacagcagtatctatctctc
agcccttcggattctgtcttgaaagatgatgatgttgagctcgatttctctgatgtcttt
ggcccactccctgaagaggccggtgatgttgccttcgacgagcctgctgttatctacact
cgttcccactctttggttggcccgtcttcgatcggtagccactcttttaagctgagcaag
cttaccttaagagagactgaggactcagttgacttggtggagtgtcttgaaaatgaattc
tctggtggtgacgacgttgacagtgagagatctccagagtgggagctggtggtgaaggtc
cctggcgtggtgggacttgatgattttgaggttatgaaggttgtagggaaaggtgcgttt
gggaaagtgtaccaggtgaggatgaaggaaacatctgagatatatgcgatgaaggtcatg
agaaaagataagattatggagaagaaccatgctgaatacatgaaagctgagcgcgatatt
cttaccaaaattgatcatccattcattgttcaacttaagtactcctttcagactaagtat
aggctctatcttgtgcttgactttataaacggagggcatcttttcttccagctctatcat
caagggcttttcagagaggacttggctcgtgtgtacactgcagagattatctctgcagtt
tcccatctccatgagaaagggataatgcatagagatctcaaacccgaaaacattctcatg
gacgtagacggccacgtgatgctaactgactttggattagcgaaggagttcgaagagaac
acaagatcaaactccatgtgcgggactactgagtatatggcacctgaaatcgttagagga
aaaggtcatgataaggctgctgactggtggagcgttgggattcttctctacgagatgctc
acaggaaagccaccgtttatggggagcagaggaaagatagagcagaaaattataaaggac
aagatcaagcttccgcagtttctatctagtgaagctcatgccttgctgaaagggttgctg
caaaaagagccagagagacgactaggaagcggacctagcggagcagaggagataaaaggg
cacaaatggttcaaggggttgaactggaagaagctggaggcaagagaagtgaagccaagt
ttcaaaccggagatatctggaagacagtgcatagcgaatttcgacaagtgttggactgag
atgtctgtgttggattccccagcaaacagtccaagctcggatcctaaggtcaatccgttc
accaacttcacgtatgtcaggcctcctccatcattccttcaacagtccacaacgactctg
tag

DBGET integrated database retrieval system