KEGG   Brassica oleracea (wild cabbage): 106295945Help
Entry
106295945         CDS       T04124                                 

Definition
(RefSeq) glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00071  Fatty acid degradation
boe00592  alpha-Linolenic acid metabolism
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
boe01212  Fatty acid metabolism
Module
boe_M00087  beta-Oxidation
boe_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106295945
   00592 alpha-Linolenic acid metabolism
    106295945
Enzymes [BR:boe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     106295945
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     106295945
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     106295945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 F420_oxidored
Motif
Other DBs
NCBI-GeneID: 106295945
NCBI-ProteinID: XP_013587413
LinkDB All DBs
Position
C5
AA seq 725 aa AA seqDB search
MASRTKGKTTMEVGGDGVAVITLINPPVNSLSFDVLENLKSNYEEALSRNDVKAIVITGA
KGRFSGGFDISGFGDIQKGTRKAPKPGHISIDIITDLLEAAKKPSVAAIDGLALGGGLEL
AMACHARISAPGAQLGLPELQLGVIPGFGGTQRLPRLVGLTKALEMILTSKPVKAEQGHS
LGLVDAVVPPAELLNAARRWALDIAERRKPWVSSVLKTDKLPPLGEAREILKFAKDQTRR
QAPNLKHPLMCLEAVEVGIVSGSRAGLEKEALISSQVVKLDTTKSLIHVFFSQRGTTKVP
GVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGLGRVKANLQ
SSVKKGRMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQH
CILASNTSTIDLNKIGERTKSQDRIIGAHFFSPAHVMPLLEIVRTNHTSAQVIVDLLDVG
KKIKKTPVVVGNCTGFAVNRMFFPYTQAAMFLVERGTDPYLIDKAVSKFGMPMGPFRLCD
LVGFGVAIATATQFIENFPERTNKSMIIPLMQEDKRAGEATRKGFYLYDEKRKAKPDPEI
KKYIEKARSVSGVNLDPKLAKLSEKEIIEMTFFPVVNEACRVFAEGIAVKAADLDIAGIF
GMGFPPYRGGIMFWADSIGSKYIYSKLDEWSKAYGGFFKPCDFLAERGSKGAPLSAPLEQ
ARSRL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacgaacgaagggaaagacgacgatggaagttggaggcgatggcgtcgccgtc
ataacgctcatcaaccctcccgtcaattcgctatcattcgacgtgctagagaaccttaaa
agtaattacgaggaggccttgagcaggaatgatgttaaagctattgttattacgggtgcc
aaggggaggttctctggtggatttgatatatctggttttggtgatattcagaaagggaca
agaaaagcgccaaagcctggacacatatcaattgacatcatcaccgatttgcttgaagct
gcaaaaaaaccgtctgttgctgccattgatgggcttgccttgggaggagggttagagctc
gcaatggcttgccatgcaaggatctcagcccctggtgcacagttaggtctgccggagctg
caactcggtgttattcctgggtttggaggaacacagcgtcttccacgtcttgttggtctt
acaaaagcccttgagatgattttgacttctaagccggttaaagctgagcaaggtcattca
ttgggtcttgttgatgctgtcgtgccacctgccgagttactaaacgctgctcgtcgctgg
gctcttgacatagccgagaggagaaaaccatgggtttctagtgttttgaagactgataag
ttacctcctcttggagaggcaagggagatactgaagtttgccaaggatcagacacgcagg
caagcccctaacctgaaacaccccttaatgtgccttgaggctgttgaagtgggtattgtt
tctggttctagggctggtttagaaaaggaggctctaatctcctcacaagtggtcaagctg
gataccaccaaaagcttgatccatgtcttcttttctcagcgaggaactacaaaggttcct
ggagttactgatcgtgggttggtgccaaggaagattaaaaaggtagccataattggaggc
gggttaatgggatctggcatagccactgcattgatcctcagtaactatccagtgattctc
aaggaggtaaatgagaagttcttggaggctggacttggcagggtcaaagctaatcttcag
agcagtgtaaagaaaggaaggatgtctcaggaaaagtttgagaaaaccatgtcactcctt
aaaggttctcttgactatgaaagctttagggatgtggacatggtcatcgaggctgtcatt
gagaatatatcattgaaacagcaaatttttgctgatctagagaagtactgtcctcaacat
tgtatccttgctagcaacacatctaccattgatttgaacaaaattggggagcggaccaag
tcccaggatcggattattggagcacattttttcagtccggcacatgtcatgccactactt
gaaatagttcggaccaatcatacatctgcacaagtaattgttgacctgttagatgttggg
aagaagatcaagaaaacgccagtggtggtgggaaactgcacagggtttgcagttaacagg
atgttctttccatacacacaggcagctatgttccttgttgaacgtggaacagatccatat
ctgattgacaaggcagtcagcaagtttggaatgccaatgggtcccttcagattgtgcgat
ttggttggattcggtgtggcgattgcaaccgctacgcaattcatcgagaactttccagaa
aggacaaacaaatcaatgattatcccactcatgcaagaggacaagagagctggtgaagcc
actcgtaaaggtttctatctttacgatgaaaagcgaaaggctaaacctgatcctgagatt
aagaaatatatcgagaaggcaaggagcgtatcaggagtgaaccttgaccctaagctggca
aaactgtcggaaaaggagattattgagatgacgtttttcccagtagtgaacgaggcttgt
agagtttttgcggaagggattgctgtcaaagcagcagaccttgacatcgctggcatattt
gggatggggtttccaccttacagaggaggaatcatgttctgggctgattccattggatcg
aaatacatttactcaaagctggatgagtggtcgaaggcttatggtggtttcttcaagcct
tgtgatttcttagctgaaaggggatctaaaggagctcctctcagtgctcccttggaacaa
gccagatcgcggttgtaa

DBGET integrated database retrieval system