KEGG   Brassica oleracea (wild cabbage): 106296934Help
Entry
106296934         CDS       T04124                                 

Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe03030  DNA replication
boe03410  Base excision repair
boe03420  Nucleotide excision repair
boe03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:boe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    106296934
   03410 Base excision repair
    106296934
   03420 Nucleotide excision repair
    106296934
   03430 Mismatch repair
    106296934
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:boe03032]
    106296934
   03400 DNA repair and recombination proteins [BR:boe03400]
    106296934
Enzymes [BR:boe01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     106296934
    6.5.1.6  DNA ligase (ATP or NAD+)
     106296934
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     106296934
DNA replication proteins [BR:boe03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    106296934
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     106296934
DNA repair and recombination proteins [BR:boe03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     106296934
   NER (nucleotide excision repair)
    Other NER factors
     106296934
   MMR (mismatch excision repair)
    Other MMR factors
     106296934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 106296934
NCBI-ProteinID: XP_013588650
LinkDB All DBs
Position
C6
AA seq 1390 aa AA seqDB search
MGSDSAGDFPNDGDAETLNLNSTELYSSAVSSSVPTPSPKPPFSPLSIPQSNRIPKTNFT
VDFFRSSPSADPSSVAFFLSHFHSDHYAGLSSSWSRGIIFSSHITARLLKQILQVPSQLV
FPLPMNQKVIIDGSEVVLIDVNHCPGAVQFLFKTNDGLERYIHTGDFRFCDSMRSDPFLS
SFVGCEGVFLDTTYCNPKFVFPTQQESVDYVINVIDKIDRESKENEKKVLFLVATYVVGK
EKILIEIAKRCKRKIFVDARKMSILNVLECGESGMFTEDKSESDVHVVGWNVLGETWPYF
RPNFAKMNEVMVERGYDKVVGFVPTGWTYEVKRNKFAVKVKDSMEIHLVPYSEHSNYDEL
REYIKLLRPKRVIPTVGVDVEKMDSREVCKMQKHFSGLVDEMANKKEFLLGFYRQSDKKS
EKDDMDISEENDAPRSDSLVTERLLIELRDSLPDWVSEEQMLDLIKKHAGNPVDIVSNFY
ECEAEFYKQSSISTSSLENHAVLVDDDGTDSQPISAKSTSSDCQASPKGFALPRKVGLTK
GVVSPGKRSKSISNKSNKKAKKDPKSRPVGPGQSTITKFFDKVLDSGSNSVAAGLETDEC
NTDEKMVHSDAKEATDQFIDIVHGSESLREYAASIIDEAKGDINRALDIYYSKPSEIPGE
HAGEGGGGLSSKSNQFPQCPEACSSQENKKTSQKSGLALNLCEQTSAEEMVDNDYVSLPP
EKYKPKEHACWRNGQPAPYIHLVRTFASVEGEKGKIKAMSMLCNMFRSVLALSPDDVLPS
VYLCTNKIAADHENIELNIGGSLISAALEEACGISRSTMREMYNRLGDLGKDKSNALTVN
VWLCRLLSKFPGDVAQLCRQTQKLLVPPPPLLVRDVFSTLRKISVQSGTGSTRQKKNLIV
KLMRSCREKEIKFLVRTLARNLRIGAMLRTVLPALGRAIVMNSFWNCHNKEPSENCFKEK
LEGVSAAVVEAYNILPSLDVVVPSLMEKDIEFSTSTLSMIPGIPIKPMLAKIANGVQDFI
KLFQDKAFTCEYKYDGQRAQIHLLLDGTVRIFSRNGDETTSKFPDLVDVIKQFACPTAET
FMLDAEVVATDRKNGNKLMSFQELSTRERGSKDALVTTKSIKVEVCVFVFDIMFFNGEQL
LTLPLRDRRRRLKEVFPETRPGFLEYATEITVGSEEASLNNQDTLCRINAFLEDAFQSSC
EGIMVKSLDVDAGYCPTKRSDSWLKVKRDYVDGLGDTLDLVPIGAWHGNGRKAGWYSPFL
MACYNPETEEFQSVCRVMSGFSDAFYIEMKEFYSEDKILAKKPPYYRTGETPDMWFPAEV
VWEIRGADLTVSPVHSAALGLVHPSRGISVRFPRFICKRADRDPEECSTAADIAEMFHAQ
TRKMNIKSQH
NT seq 4173 nt NT seq  +upstreamnt  +downstreamnt
atggggtccgactccgccggcgacttcccaaacgacggcgacgcagaaaccctaaacctc
aactctacagaactctactcatcagcagtttcctcctccgttcctacaccctccccgaaa
ccaccgttctctcctctctcaatccctcaatcaaacagaatccccaaaaccaacttcacc
gtcgacttcttccgctcctccccctccgccgatccctcctccgtcgctttcttcctctca
cacttccactccgaccactacgccggcctctcctcttcctggtccagaggaatcatcttc
tcctctcacataaccgcacgccttctcaaacaaatcctccaagtcccgtcacaactcgtc
ttccctctacctatgaatcaaaaagttatcatcgatggctccgaggttgttcttatcgac
gtgaatcactgcccaggagctgtacagttcctcttcaaaaccaacgacggtctcgaacgg
tacattcacaccggagacttcagattttgcgattcgatgagatcagatccgtttctaagt
agcttcgttggctgcgaaggtgtttttctcgacactacttattgcaacccgaagttcgtt
ttccccacgcagcaagagtctgttgattatgtgattaacgtgatagataagatcgataga
gagtctaaggaaaatgagaaaaaagttttgtttcttgttgctacttatgttgttggcaaa
gagaagattttaattgagattgctaagagatgcaagaggaagatcttcgtggacgcgagg
aagatgtcgattttgaacgtcttggagtgtggagagagtggaatgttcactgaggataag
agcgagagcgatgttcacgttgtgggatggaatgtgttgggcgagacttggccttatttt
cggccgaatttcgccaagatgaatgaggttatggttgagagagggtatgataaggttgta
ggttttgtgcctacagggtggacgtatgaagtgaagaggaataagtttgctgtgaaggtt
aaggattctatggagattcatcttgtgccgtatagtgagcattcgaattatgatgagctt
agggagtacataaagttgttgaggcctaaaagagttattcccacggttggtgttgacgtc
gagaagatggacagcagggaggtttgtaaaatgcagaagcatttttctggacttgttgat
gagatggcgaacaagaaagagtttttattgggtttctatcgccagtctgacaagaagagt
gagaaagatgacatggatattagcgaagaaaatgatgctccaagaagtgattctttggtg
actgaaagattgctgattgaactacgtgattctttgcctgattgggtcagtgaagagcag
atgttagatctgattaagaaacatgctggtaaccctgttgatatagtgagtaacttctat
gaatgcgaagcagagttttacaagcaatcctcgatttccacatcttccttggagaatcat
gctgttctggttgatgacgatggaaccgactcgcagccgatttctgctaagagcacttcg
tcagattgtcaagcaagtccaaaagggtttgcattaccaagaaaagttggtttaacaaag
ggtgttgtttctcccgggaaaagaagcaaaagcattagcaataagtcaaacaagaaggcc
aagaaagatccaaagtcgagaccagttggtccagggcagtcaaccataactaagtttttc
gataaggtgttggatagtggatctaattctgttgctgctggtttagagactgatgaatgc
aatacagatgaaaagatggtccacagtgatgctaaagaagcaacagatcaatttattgac
attgttcatggttctgagtctttaagagagtatgctgcttccatcattgatgaggctaaa
ggagatataaatagggcactggacatctattatagtaaacccagtgaaatacctggtgag
catgcaggtgagggaggaggaggactctctagcaaatcaaatcagtttccgcaatgtcca
gaagcgtgctcctcccaggagaacaaaaagacgtcacaaaaatcaggacttgcattgaac
ttatgtgagcagacatcagcagaagaaatggtggacaatgattatgtatctctaccgcct
gaaaaatataagcctaaagagcatgcttgttggaggaatggacagcctgctccatatatc
caccttgtccggacatttgcttccgtcgaaggtgaaaagggcaagatcaaagctatgtct
atgctttgcaacatgtttagaagcgtgttggctctctctccagatgatgtgctgccctct
gtttatctttgcacaaataagattgccgctgaccatgagaatattgagctcaacattggt
ggaagtctgatctctgctgcattggaagaagcatgtggaataagtcggtctactatgagg
gagatgtataatagattgggagatcttggtaaagacaaatctaacgctctcacagttaac
gtatggttatgtcgtttattatcaaaatttccaggtgacgttgctcagctgtgccgacaa
acgcaaaagctactagttcctccacctccacttctagttagagatgtgttttcaactcta
cgaaagataagtgtgcagtcaggtactggaagtactaggcaaaagaaaaacctcatcgtg
aaactaatgcgctcttgtagagagaaagagataaaatttcttgtcagaacattggcccgt
aatttaaggattggcgctatgttgagaactgttctacctgcactagggagagcaattgtt
atgaattctttctggaattgccataacaaagaaccatcagaaaattgtttcaaagagaaa
ctggagggtgtttctgctgcagtagttgaggcctataatatacttccttctctggacgtg
gttgttccttctctcatggaaaaagacattgagttttcaacatcaactctgtcaatgatc
ccagggatacctataaaacccatgcttgcaaaaattgccaacggggttcaagattttatc
aagctcttccaagacaaggcctttacatgtgaatacaagtatgatggccagcgcgcccag
attcatttgttacttgatggtacagtgcggattttctctcgaaatggggatgaaactact
tccaaatttcctgatctggttgatgttataaaacagtttgcttgccctactgctgagaca
ttcatgttggacgcagaggttgttgcaactgatagaaagaatggaaacaaactcatgtca
ttccaagagttatcaacaagagagcgagggagcaaagacgctttggtaactacaaaaagt
attaaggttgaagtctgcgtctttgtgtttgatattatgttcttcaacggtgaacagctg
ttgactcttcccctccgtgatagacgaagacgtctaaaggaggtcttccctgagactagg
ccaggttttctcgagtatgctacggaaatcactgtgggatcagaagaagcgtctttgaat
aaccaagacactttgtgtagaataaatgcgtttctagaagacgcatttcagtcatcttgt
gagggaatcatggttaagtctttagatgttgatgccggttactgccccacaaagcgttcc
gattcatggcttaaggttaagcgagattatgtagatggattaggtgacacattggattta
gttcctataggtgcttggcatggcaacgggagaaaagcgggatggtatagtccattcctc
atggcctgctacaaccctgagactgaggaattccagagtgtctgccgtgtcatgtctggg
ttttctgatgccttttacatcgagatgaaagaattctactccgaggataagatccttgcg
aaaaagccgccatactacagaacaggggagacaccagacatgtggtttcccgcagaggtt
gtttgggaaatcagaggagcggatctaaccgtctcacctgtacacagtgcggctttaggt
ctggtacatccatcacgaggcatctccgttaggtttccgagattcatctgtaaaagggcg
gatagggatccggaggaatgcagcacggctgcagatatagcagagatgtttcatgctcaa
accagaaaaatgaacattaagtctcaacactaa

DBGET integrated database retrieval system