KEGG   Brassica oleracea (wild cabbage): 106298256Help
Entry
106298256         CDS       T04124                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic isoform X1
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00010  Glycolysis / Gluconeogenesis
boe00020  Citrate cycle (TCA cycle)
boe00620  Pyruvate metabolism
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
boe01200  Carbon metabolism
Module
boe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106298256
   00020 Citrate cycle (TCA cycle)
    106298256
   00620 Pyruvate metabolism
    106298256
Enzymes [BR:boe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     106298256
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-GeneID: 106298256
NCBI-ProteinID: XP_013589808
UniProt: A0A0D3CRS4
LinkDB All DBs
Position
C6
AA seq 456 aa AA seqDB search
MSRLLNTSFLPCSTCRTRSSSAPHSRVNKPRIVSVRAKIREIFMPALSSTMTEGKIVSWV
KSEGDKLSKGESVVVVESDKADMDVETFYDGYLAAIMVEEGGVAPVGSAIALLAETEEEI
ADARAKASGGGGGTSPSPPVSQAPPVVEEKVSASVPPPKVVSSASAVHPASEGGKRVVAS
PYAKKLAKELKVELAALVGSGPMGRIVAKDVEAAVAAAPPVQKEAMAPAVAVELGSVVPF
TTMQGAVSRNMVESLSVPTFRVGYTINTDALDALYKKIKSKGVTMTALLAKATALALAKH
PVVNSSCRDGNSFVYNSSINIAVAVAIDGGLITPVLQNADKVDIYSLSRKWKELVDKARA
KQLQPQEYNTGTFTLSNLGMFGVDRFDAILPPGTGAIMAVGASQPTVVATKDGRIGMKNQ
MQVNVTADHRVIYGADLAQFLQTLASIIEDPKDLTF
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtcttctcaacacgtcgttccttccttgttccacttgcagaacccgatcctcc
tccgctcctcattcccgcgttaacaagccacgaatcgtcagcgtccgggcgaagatccga
gagatcttcatgcctgctctcagctccaccatgaccgaaggcaaaatcgtgtcctgggtc
aaatccgaaggcgacaagctcagcaaaggggagagtgttgtggtcgtcgaatccgacaag
gcagatatggacgtggagactttctacgacggttatctcgccgcaatcatggtcgaggaa
ggcggtgtggctcccgttggatccgccattgctttgttagctgagactgaggaagaaatc
gcggatgctagggctaaagcttccggtggtggtggaggcacttctccatctccgcctgtc
tcccaagcacctccggttgttgaagagaaggtttcggcttcggttcctccgccgaaagtt
gtgtcttccgcgtcggctgtgcatccggcgtcggaaggagggaagagagtggtggcttct
ccttatgccaagaagctagcgaaggagttgaaagtggagttggctgctttagttggaagc
gggccaatgggaaggattgttgctaaagatgttgaagccgctgttgctgctgctcctcct
gttcaaaaggaggctatggctcctgctgttgctgttgagctcggctccgttgttccattc
accacaatgcaaggcgccgtgagcaggaacatggttgagagcttgtcggttcctactttt
agagtcggttacacaatcaacaccgatgctcttgatgctctctacaagaagattaagtct
aaaggtgtgacaatgacggcactactagcaaaggcaactgcacttgcactcgcaaaacat
ccagttgtaaactcttcctgcagagatggtaacagttttgtgtataacagtagcatcaac
attgctgttgctgttgccattgatggtggtttgatcactcctgtccttcagaacgccgat
aaggttgacatttattcattgtctagaaaatggaaagaattggttgataaggcccgagcc
aagcagctgcagccccaggagtacaacactggtactttcactctctctaacctcggaatg
ttcggtgttgatcggtttgatgcaattcttccccctggaactggagcgattatggctgta
ggagcatcacaacctacagtggttgctactaaagacggccgcatcggcatgaaaaaccag
atgcaggtgaatgtgacggcagatcatcgtgttatctatggtgctgatctcgcacagttc
ttgcaaacattggccagcattattgaggacccaaaggaccttacattctag

DBGET integrated database retrieval system