KEGG   Brassica oleracea (wild cabbage): 106298400Help
Entry
106298400         CDS       T04124                                 

Definition
(RefSeq) hexokinase-like 1 protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00010  Glycolysis / Gluconeogenesis
boe00051  Fructose and mannose metabolism
boe00052  Galactose metabolism
boe00500  Starch and sucrose metabolism
boe00520  Amino sugar and nucleotide sugar metabolism
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
boe01200  Carbon metabolism
Module
boe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
boe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106298400
   00051 Fructose and mannose metabolism
    106298400
   00052 Galactose metabolism
    106298400
   00500 Starch and sucrose metabolism
    106298400
   00520 Amino sugar and nucleotide sugar metabolism
    106298400
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106298400
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:boe04131]
    106298400
Enzymes [BR:boe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106298400
Membrane trafficking [BR:boe04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106298400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 106298400
NCBI-ProteinID: XP_013589969
UniProt: A0A0D3CNZ8
LinkDB All DBs
Position
C6
AA seq 496 aa AA seqDB search
MSLFTFAASPLVITPTVRSFTFSPPRCSKQTVMSAVRSESTSTCPVLTKFQKNCATPTTF
LRVVADAIADDMQAGLAVHGGGDLEMILTYVDALPSGKEEGLFYALDLGGTNFRVRSVQL
GGEEERVVATKSEQLSIPQKLMIGTSEELFGFIASKLADFVAMEEPGRFRLEHGRKREIG
FTFSFPVNQTSIDSGTLTKWTKGFNVSGMEGKNVVACLNEAMEAHGLDMRVSALVNDGVG
TLAGARYWDKDVMAGVILGTGTNACYVEQKHAIPKLQNQSSSGTTIINTEWGGFSKCLPR
TIFDQEMDKDSLNPGEHLYEKMISGMYLGEIVRRVLLHMCQTSDLFGQSVPAKLATPLTL
KSQDLCKMQEDDTDDLSSVGSILYNIFEVKADLKERRRVVEVCDTVVKRGGRLAGAGIVA
ILERIERETKRLASGQRTVVAMDGALYEKYPQYRQYMQDALVELLGDELACHVQIKHTKD
VSGLGAALLAATNSIY
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcactcttcacctttgctgcttcccctcttgttattaccccaaccgttagatctttc
accttctcaccaccccgttgctccaaacaaactgtaatgtccgccgtccgatctgagtcc
acttcaacatgtcctgttctgaccaagtttcagaagaactgtgccacccctacaacgttc
ttacgcgtcgtagccgacgccattgctgatgacatgcaagccggtctagctgtccatgga
ggaggagatctcgagatgatcttgacttatgtggatgctttgccttctggaaaggaggaa
ggtttgttctatgcattggatttaggtggaacaaactttcgggtgcgtagcgtacagtta
ggaggagaggaagaacgtgtcgtagctaccaaatctgagcaactatctattcctcagaag
cttatgattggtacaagtgaggaactcttcgggttcatcgcttcaaagctcgcagatttc
gtggcaatggaggagccagggcggtttcggttggaacacgggaggaaaagggagattggg
tttactttctccttccctgtgaatcaaacctccattgattcaggaacacttaccaagtgg
actaaaggctttaatgtgtctggaatggaaggtaaaaacgtggttgcatgtttaaatgaa
gctatggaagcacatggacttgatatgcgagtttctgctcttgtaaatgatggagtggga
acattagctggagcaaggtattgggacaaagatgtgatggccggtgtgattcttggcact
gggaccaatgcttgttatgttgagcagaagcatgcaattcctaaactccaaaaccaatct
tcttctggaacaacgatcataaacacagagtggggaggtttctctaagtgtcttccacga
accatttttgaccaagagatggataaggatagcttaaatcctggtgaacatttatatgag
aagatgatctcggggatgtaccttggtgaaattgtgaggagagttttgctccatatgtgt
caaactagtgacttgttcggacaatccgttcctgccaaactagcaactcctttgacactc
aagagccaggatctatgcaaaatgcaagaggacgatacagatgatctttcaagtgttgga
tcgatcctatacaacatttttgaggtaaaggcggatctgaaggagaggaggagagtggtg
gaagtgtgtgacacggtagtgaaacgcggaggacgtctagcaggagctggtatagtggca
attctggagaggattgagagagagacaaaaagactggcttcaggtcaaagaaccgttgtg
gctatggacggcgcactctacgagaagtacccgcagtatcgacagtatatgcaagatgca
ctagttgagcttcttggtgatgaacttgcatgtcacgttcagattaaacataccaaagat
gtgtctgggcttggtgctgctcttttggccgctactaactccatttattag

DBGET integrated database retrieval system