KEGG   Brassica oleracea (wild cabbage): 106301381Help
Entry
106301381         CDS       T04124                                 

Definition
(RefSeq) histone deacetylase 5-like
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
boe  Brassica oleracea (wild cabbage)
Brite
KEGG Orthology (KO) [BR:boe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:boe01009]
    106301381
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:boe03019]
    106301381
   04131 Membrane trafficking [BR:boe04131]
    106301381
   03036 Chromosome and associated proteins [BR:boe03036]
    106301381
Enzymes [BR:boe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     106301381
Protein phosphatases and associated proteins [BR:boe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106301381
Messenger RNA biogenesis [BR:boe03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     106301381
Membrane trafficking [BR:boe04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    106301381
Chromosome and associated proteins [BR:boe03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     106301381
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 106301381
NCBI-ProteinID: XP_013593215
UniProt: A0A0D3DDI0
LinkDB All DBs
Position
C7
AA seq 647 aa AA seqDB search
MAMAGESSNNNYRDCDGKSHRKVGLVYDETMCKHDTPNGEDHPECPDRIRVIWEKLQLAG
VSQRCVVFGGSKAEDKHLQLVHTKDHVSVVKSLSTKKKDYRRNRIASQWNSIYLNGSSSE
AAFLAAGSVVELAEKVAEGELDCGYAIVRPPGHHAEPDEAMGFCLFNNVAVAASYLLDER
PELGVKKILIVDWDVHHGNGTQKMFWKDPRVLFFSVHRHEHGGFYPAGDDGDYNMVGEGP
GEGFNINVPWEQGRCGDADYLAAWDHILIPVAKEFNPDIILLSAGFDAAIGDPLGGCRVT
PYGYSVMLKKLMEFAKGKIVLALEGGYNLDSIAKSSLACVQVLLEDKPIQGSSEAYPFES
TWRVIQAVRKKLSAYWPSLADVLSSKLIDQKTPTPIIVFSSSDSETEDYADDILDQMSRL
NIENHHVDTVSTSWRRDLSKVDVWYASFGSNMWKPRFLCYIQGGQVEGMKKVCVGSMDKT
PPKQIMWESFPHRLFFGRESSVTWGVGGVAFINPLTNLNDQTHMCLYRITLEQFNDVLFQ
ENGLKVDSDSPLFGLDTLQLVEKKGSIPLASGGWYGNIVCLGKECDIPILTMTCTLSAVE
KFKSGEIPLRPPSEAYANTMIRGLVEGGRLSEEEAKAYIHNAASKPL
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggccggtgaatcttctaataacaactacagagactgtgacgggaagagtcat
cgaaaggtgggtcttgtctatgacgagacgatgtgcaaacacgacacacctaacggcgag
gatcaccctgagtgtcctgatcgcatcagagttatctgggagaagctccagctcgccgga
gtctctcaaagatgtgtggtttttggtggtagcaaagctgaagacaagcatctccaattg
gttcacacaaaggaccatgttagtgtagttaagagtttaagcacaaagaagaaagattac
cggagaaacaggattgcttcacagtggaattcaatatatctgaatggaagttcatctgaa
gccgcgtttcttgcagctggatctgttgtagagttggcggagaaagttgcagaaggagag
ttggattgtgggtatgctattgtcaggcccccagggcaccatgctgagccagatgaagct
atgggtttctgtttgttcaacaacgtagcagtcgctgctagctatttacttgatgaaaga
cctgaactaggtgtcaagaagattctgattgttgattgggatgtccatcatggaaatggc
acgcagaagatgttctggaaagatcctcgtgtactgtttttctctgttcacaggcacgaa
cacggaggcttctatccagcgggtgatgatggagactacaacatggttggggaaggtcca
ggtgaagggtttaacataaacgttccatgggaacaaggaagatgcggagatgcagattat
cttgccgcatgggaccatattttgattcctgtggcgaaggagtttaatcctgatattatt
ttgttatcagctggatttgatgcagctattggtgatccacttgggggctgtcgtgtaaca
ccatatggatattcagttatgttgaagaagctgatggagtttgcaaaaggaaagattgtg
ttggcgttagagggagggtacaatcttgactcaattgcaaagtcttcactggcatgtgtc
caagtcttgcttgaagacaaaccaattcaaggttcttctgaagcatacccattcgagtct
acatggcgtgtcatacaagcggtacgaaagaagctgtctgcatattggccttcacttgca
gatgtattatcatcgaagctcattgatcagaaaactcccactccaattattgttttctca
agctccgactctgaaactgaagactacgctgatgatatcctagatcaaatgtcgagactc
aacattgaaaaccaccacgtagatacagtttctacatcttggagaagagatctctcaaaa
gttgatgtctggtatgcctcttttggatccaacatgtggaaaccaaggttcctttgctat
attcaagggggacaagtagagggaatgaaaaaggtctgcgttggttcaatggataaaact
ccaccaaagcaaataatgtgggaatcatttccacacaggctgttctttggacgtgaatca
tcagttacttggggtgtaggaggagttgctttcatcaacccacttactaatctcaatgat
caaactcacatgtgtttgtacagaatcacgcttgagcagttcaacgatgttctgtttcag
gaaaatggattgaaagtagattctgattctccgctctttggtctagatactctgcagtta
gtagagaagaaaggatccattccacttgcttcgggtggttggtatggaaacattgtctgc
ttggggaaagaatgcgacatccctatacttacaatgacttgcacactatctgctgttgag
aagttcaaatccggtgagatccctttaagacctccttcagaagcatatgcaaacactatg
ataagagggcttgttgaaggaggaagattatctgaagaagaagctaaagcttacatacac
aatgctgcatctaaacctctctag

DBGET integrated database retrieval system