KEGG   Brassica oleracea (wild cabbage): 106304796Help
Entry
106304796         CDS       T04124                                 

Definition
(RefSeq) methyl-CpG-binding domain protein 4-like protein
  KO
K10801  methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:boe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    106304796
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:boe03036]
    106304796
   03400 DNA repair and recombination proteins [BR:boe03400]
    106304796
Enzymes [BR:boe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     106304796
Chromosome and associated proteins [BR:boe03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    106304796
DNA repair and recombination proteins [BR:boe03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     106304796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HhH-GPD Ubiq-Cytc-red_N Exo70
Motif
Other DBs
NCBI-GeneID: 106304796
NCBI-ProteinID: XP_013596644
UniProt: A0A0D3D2F7
LinkDB All DBs
Position
C7
AA seq 387 aa AA seqDB search
MMAHQVKFHMPNDDSSVTRTRRASPNHLNDRPSSECDGSNCQEKGTRNSFVSCRSLDDLL
SECTYKGVRRKTWNGFGSKTRTKLVTSGNTVKDDSDSVFESHSERQECSESLTQVRRVSP
YFQHKQGCNSDSESSKTQSGSSTRKAKVQRVSPYLQASTRKTCSKAQPKVRKVSPYFQGS
TVPNQPRDMRQYFKVVKVSRYFHGLSAQVNESQKEIPRRARKTPLVSPSLSQSQKTDEAY
LRKTPDNTWVPPPSPCNLLQEDHWHDPWRVLVICMLLNKTSGAQTRGVISDLFALCPNAK
TATKVEEKEIETLIKPLGLQNKRSKMIKRFSLEYLQESWTHVTQLHGVGKYAADAYAIFC
NGKWDCVRPDDHMLNYYWEFLRIRFRL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgatggctcatcaagtgaaatttcatatgcctaacgatgatagttcagtgacgaggact
cgtcgggcctcgcctaaccatttaaacgacagacccagctccgagtgtgatggtagtaat
tgccaggagaaggggacaagaaacagttttgtttcgtgtagaagtttggatgatttgttg
tctgagtgtacttataaaggtgtgaggaggaagacatggaatgggtttggaagtaaaacc
agaactaagcttgttacttcagggaacacagtaaaggatgatagtgatagtgtttttgaa
tctcacagtgaaagacaagaatgtagtgaatctctgactcaagtaagaagagtttctccg
tacttccagcacaaacaagggtgtaattctgatagtgagtcttctaaaacgcaaagtgga
agcagtactaggaaagctaaagtccaaagagtttctccatacttgcaggcatcaactagg
aaaacatgcagcaaagctcaacctaaagtccgaaaagtttctccatacttccagggatca
actgttccaaaccagccaagagatatgcgtcaatactttaaggtcgtgaaagtttcaaga
tatttccatggcctgtctgcccaagtaaatgaatcacaaaaggagataccaagaagggcg
aggaaaactcctcttgtgagtccttctctgtctcagtctcagaagactgatgaggcatac
ctgcggaaaacgcctgataacacatgggtgcctccgccatctccatgtaatctacttcaa
gaagatcactggcatgatccatggcgggtgctggtcatatgtatgcttctcaacaaaact
tctggtgcacagacgcggggggtgatatcagacctgtttgcgctgtgtcctaatgcaaag
actgctacaaaagtcgaagagaaagagatagagactctgataaagcctcttggactacag
aataagagatccaaaatgataaaacggttttctctcgagtatcttcaagagagctggact
catgtgactcaactgcatggcgttggaaagtatgcagcggatgcgtatgccatattctgt
aatgggaagtgggattgtgtgagacctgatgatcatatgctaaactattactgggaattc
ctcaggattcggtttaggttatga

DBGET integrated database retrieval system