KEGG   Brassica oleracea (wild cabbage): 106306264Help
Entry
106306264         CDS       T04124                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00010  Glycolysis / Gluconeogenesis
boe00020  Citrate cycle (TCA cycle)
boe00620  Pyruvate metabolism
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
boe01200  Carbon metabolism
Module
boe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106306264
   00020 Citrate cycle (TCA cycle)
    106306264
   00620 Pyruvate metabolism
    106306264
Enzymes [BR:boe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     106306264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DciA DUF3528
Motif
Other DBs
NCBI-GeneID: 106306264
NCBI-ProteinID: XP_013598276
UniProt: A0A0D3DAW5
LinkDB All DBs
Position
C7
AA seq 476 aa AA seqDB search
MAVSSSSFLSTPFLSNSKSTISFAYSVSPAPIPSLRRVVFRSHRRAMTVRSKIREIFMPA
LSSTMTEGKIVSWLKTEGEKLAKGQSVVVVESDKADMDVETFYDGYLAAIVVGEGETAPV
GAAIGLLAETEAEIEEAKNKAASKSSAAVAPSPPPPPATSSPAPAIAQPAPVAAVSDGPR
KTVATPYAKKLAKQHKVDIGSIAGTGPFGRITASDVEAAAGIAPSVAPPPPPPPASAAAT
AKATATSSPPLLPDSSVVPFTAMQSAVSKNMIESLSVPTFRVGYPVNTDALDTLYEKVKP
KGVTMTALLAKAAGMALAQHPVVNASCKDGKSFTYNSNINIAVAVAINGGLITPVLQDAD
KLDLYLLSQKWKELVGKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAV
GASKPTVVADKDGFFSVKNKMMVNVTADHRIVYGADLAAFLQTFAKIVENPDSLTL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcggtctcttcttcctcgtttctatcgacaccttttctctccaactccaaatccacc
atttcattcgcttactccgtctccccagcccccatcccctccctccgccgcgtcgttttc
cgctctcaccgcagagcaatgacggtccgatccaaaatcagagaaatcttcatgccggcg
ctctcctccaccatgacggaagggaagatcgtatcctggctcaagaccgaaggcgagaag
ctcgcgaagggacagagcgtagtcgtcgtggagtccgataaggccgatatggatgtagaa
accttctacgacggttacctcgccgcaatcgtcgtcggagaaggagagacggctccggta
ggcgctgctattggattgcttgcggagactgaggctgaaatcgaagaagctaagaacaaa
gccgcctcgaaatcctccgccgccgttgctccatctcctcctcctcctccggctacttca
tctcccgcgccggcgatcgctcagcctgctccggtggcggctgtgtcagatggtccgagg
aagaccgtggcgacgccttacgctaagaagctcgcgaagcagcataaagtggatatcgga
tccatagcaggaactggaccgttcggtaggatcacggcttctgacgtggaggcggcggcg
ggaatcgctccctccgtggcaccaccgcctcctcctcctcctgcttctgctgctgcgacg
gcgaaagctaccgcaactagctcgcctcctctgttgcctgactccagcgttgttcccttc
actgcaatgcaatctgcagtttccaaaaacatgatcgagagcctctccgttccaacattc
cgtgttggttatcctgtgaacactgatgctcttgatacgctctacgagaaggtgaagcca
aagggtgtaacaatgactgcgttattggctaaagctgcagggatggctcttgctcagcat
cctgtggtgaacgctagctgcaaagatggcaagagttttacttacaatagtaacattaac
atcgccgttgctgttgccatcaatggcgggttgattactcctgttctgcaagatgctgat
aagttggatttatacttgttatcccaaaaatggaaagagctggttgggaaagctagaagc
aagcaattgcaacctcatgagtacaactctggaacttttactttatccaatctcggtatg
tttggagtggatagatttgatgctattcttcctccaggacagggtgctattatggctgtt
ggagcgtcaaaaccaactgtagttgctgataaagatggtttcttcagtgtgaaaaacaaa
atgatggtgaatgttacagcagatcatcgcattgtgtatggagctgacttggctgctttc
cttcagacctttgcaaagattgttgagaatccagatagcttgaccttgtag

DBGET integrated database retrieval system