KEGG   Brassica oleracea (wild cabbage): 106306618Help
Entry
106306618         CDS       T04124                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00020  Citrate cycle (TCA cycle)
boe00190  Oxidative phosphorylation
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
boe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106306618
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106306618
Enzymes [BR:boe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106306618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 106306618
NCBI-ProteinID: XP_013598748
LinkDB All DBs
Position
C7
AA seq 627 aa AA seqDB search
MWRCVSRSLRAPSSRTSLSGSRFSRFLSTGSQTGDYTIVDHTYDAVVVGAGGAGLRAAIG
LSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQDAI
QYMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHA
LLHTLYGQAMKHNTQFFVEYFALDLLMASDGTCQGVIALNMEDGTLHRFRSAQTILATGG
YGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGIL
RNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPHKDHIYLHLNHLPPEVLKE
RLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMA
AGEAACASVHGANRLGANSLLDIVVFGRACANRVAEISKPGEKQRPLEENAGKKTIEWLN
KLRHSSGSLPTSSIRLNMQRIMQNNAAVFRTQETLEEGCQLIDKAWESFEDVQVKDRSLI
WNSDLIETIELENLLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEK
VRLEYRPVHMDTLDDEIDTFPPKARVY
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtctctcgtagccttcgtgctccttcctcaaggacctcactctctgga
tctcgcttttctagattcctctccaccggttcccagacaggtgattacacgatagtagat
cacacctatgatgcggtggttgttggagctggtggtgctgggctaagggcggccattgga
ttatctgagcatggatttaacaccgcttgcatcaccaagctcttccccacacgctcacac
accgtcgctgctcagggtggtattaatgctgcactgggaaacatgtctgaagatgactgg
agatggcacatgtatgatactgtcaaaggaagtgactggcttggtgatcaagatgccatt
cagtatatgtgtagagaggcaccaaaagcagtgattgaacttgagaattacggcctgccc
ttttctcgtactgaagagggtaaaatttaccagcgtgcatttggtggtcagagtcttgac
tttggcaaaggtggtcaggcctatcgttgtgcttgtgctgcggatcggactgggcatgct
ctcttgcataccttatatggacaagctatgaagcataacacacagttctttgttgaatac
ttcgctctggatctgctcatggcgagtgatggcacttgccagggtgtaattgcactaaac
atggaagatggaacattgcaccgtttccgctctgcacaaacaatcttggccactgggggt
tacggcagagcatacttctctgcaacctcagcacatacatgcacaggagatggcaatgcc
atggttgcacgtgctggtcttccactccaggacttggagtttgttcagttccatccaact
ggtatttacggagccggatgtctcatcactgaaggatcccgaggtgaaggtggtatcctt
agaaacagtgaaggagaacgttttatggaacgatatgctcctacagccaaggatcttgca
tcaagagatgttgtctctagatctatgactatggaaatcagggaaggtcgtggtgtagga
ccgcataaggatcatatctatctccatttgaaccatctcccaccagaagttctaaaagaa
aggcttcctggaatatctgagaccgctgcaatcttcgctggtgttgatgttaccaaagag
ccaattccagtcttgcctactgtgcactataacatgggtggtatcccaacaaattaccac
ggcgaggtagtgaccatcaaaggagatgatccagatgcagtggttccagggcttatggct
gctggggaggcagcttgtgcatctgttcacggtgccaacaggcttggtgcaaattctctc
ctcgacattgttgtgtttggccgtgcttgtgcgaatagggtagcagagataagcaaacca
ggggagaaacagaggcctctggaggaaaatgcaggcaagaagacgatagaatggctgaac
aagttgagacactcaagcgggtcgcttcctacatcaagtatcagattgaacatgcagagg
attatgcagaacaacgcagctgtcttccgcacgcaagaaacattggaagaaggttgtcag
ttgatcgacaaggcatgggaaagtttcgaggatgtccaggttaaagatcggagtttgata
tggaactctgatctgatagagacaatagaactggagaacctattgataaacgcttcaata
acaatgcattcagcggaagcacgaaaggaaagcagaggagcacatgctcgggaagatttc
acgaaaagagaggatggagaatggatgaagcatacattggggtattgggaagacgagaaa
gtgaggttggagtataggcctgttcacatggacactctcgacgatgagattgacactttc
cctcccaaagctcgcgtctactga

DBGET integrated database retrieval system