KEGG   Brassica oleracea (wild cabbage): 106311632Help
Entry
106311632         CDS       T04124                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00010  Glycolysis / Gluconeogenesis
boe00053  Ascorbate and aldarate metabolism
boe00071  Fatty acid degradation
boe00280  Valine, leucine and isoleucine degradation
boe00310  Lysine degradation
boe00330  Arginine and proline metabolism
boe00340  Histidine metabolism
boe00380  Tryptophan metabolism
boe00410  beta-Alanine metabolism
boe00561  Glycerolipid metabolism
boe00620  Pyruvate metabolism
boe00903  Limonene and pinene degradation
boe01100  Metabolic pathways
boe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106311632
   00053 Ascorbate and aldarate metabolism
    106311632
   00620 Pyruvate metabolism
    106311632
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106311632
   00561 Glycerolipid metabolism
    106311632
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    106311632
   00310 Lysine degradation
    106311632
   00330 Arginine and proline metabolism
    106311632
   00340 Histidine metabolism
    106311632
   00380 Tryptophan metabolism
    106311632
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106311632
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    106311632
Enzymes [BR:boe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     106311632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 106311632
NCBI-ProteinID: XP_013604322
UniProt: A0A0D3DR99
LinkDB All DBs
Position
C8
AA seq 538 aa AA seqDB search
MAARRVSSLLSRSFSASSPFLSRSQGRNLNNGSRIVRRFGTSSAAEEVISPSVQVSYTKL
LIDGNFVDAASGKTFPTLDPRTGEVIAHVAEGDAEDINRAVKAARKAFDEGPWPKMTAYE
RSRVMLRFADLVEKHSEELAALESWDNGKTYEQALTAEIPMVARLFRYYAGWADKIHGLT
VPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTAEQTPLTAFY
VGKLFLEAGLPPGVLNIVSGFGATAGASLASHMDVDKLAFTGSTDTGKVILGLAANSNLK
PVTLELGGKSPFIVFEDADIDKAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKAK
ARALKRVVGDPFKKGIEQGPQVDSKQFEKVMKYIRSGVESNATLECGGGQVGDRGYFIQP
TVFSNVKDDMLIAQDEIFGPVQSILKFSDVDEVIKRANDTRYGLAAGVFTKSLDTANRVS
RALKAGTVWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTPLNNPAWI
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcgtagagtgtcttccctattgtcacgatccttttcagcttcctctcccttt
ctctctcgttctcaaggaagaaatttgaataatggaagtaggattgtacggagattcgga
acctcttctgcagctgaagaagtgataagcccgtcggttcaagtttcttacacaaagctc
ctcatcgatgggaacttcgttgacgctgcttctggcaagacgttcccgactcttgatcca
cgcacaggggaagtcattgcgcacgtagctgaaggagatgctgaagatatcaaccgggct
gtgaaagctgcaaggaaggcctttgatgaaggaccttggcctaagatgactgcttatgaa
aggtcgagggtaatgttgagattcgctgatttggtcgagaaacacagcgaagagctcgcg
gctctagagtcatgggacaatgggaagacttatgaacaagcactaacagcagagattcca
atggtcgccagattgttccgctactatgctgggtgggcggataagattcatgggcttaca
gttccagctgacggaaactatcatgttcagacgctgcatgaacccataggcgttgctgga
cagatcattccctggaactttcctcttttgatgtttgcttggaaagttggtcctgctctt
gcttgtggtaacaccattgtcctcaaaaccgctgaacagactcctctcactgctttctac
gtcggcaaacttttccttgaagcgggtcttcctcctggtgttctgaatattgtttctgga
ttcggcgcaaccgctggtgcttctctcgcaagtcacatggatgtagacaagcttgctttc
acgggatcgactgatactggtaaagttatacttggactggctgctaacagcaatctcaag
ccggtgactctggaacttggagggaagtcaccgttcatcgtattcgaagacgctgatatt
gataaagctgtggagcttgctcactttgctctcttctttaaccaggggcaatgttgctgc
gcggggtctcggacatatgttcatgagaaagtgtatgatgagttcgttgagaaagcaaag
gcacgcgctttaaaacgtgtggttggtgatcctttcaagaaaggcattgaacagggtcct
caggtcgactcaaagcaattcgagaaagtgatgaagtacataaggtcaggagtggaaagc
aatgctactcttgaatgtggtggtggtcaggttggagacagaggctacttcatccaacct
acagtcttttctaatgttaaggacgacatgcttatcgctcaagacgagatttttggtcca
gtccagtccatcttgaagttcagtgatgttgatgaggtgataaagagggcgaacgacact
aggtacgggctagccgcaggggttttcacaaagagcctggacactgcaaatagggtgtcg
agggctttgaaagctggcaccgtttgggtcaactgtttcgatgtctttgacgcagccatc
ccctttggtggttacaagatgagcggcaacggcagagagaaaggtatttacagtctcaac
aactacttgcaggtcaaggcagtcgtcactccccttaataaccctgcatggatctga

DBGET integrated database retrieval system