KEGG   Brassica oleracea (wild cabbage): 106312404Help
Entry
106312404         CDS       T04124                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe03030  DNA replication
boe03410  Base excision repair
boe03420  Nucleotide excision repair
boe03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:boe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    106312404
   03410 Base excision repair
    106312404
   03420 Nucleotide excision repair
    106312404
   03430 Mismatch repair
    106312404
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:boe03032]
    106312404
   03400 DNA repair and recombination proteins [BR:boe03400]
    106312404
Enzymes [BR:boe01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     106312404
    6.5.1.6  DNA ligase (ATP or NAD+)
     106312404
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     106312404
DNA replication proteins [BR:boe03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    106312404
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     106312404
DNA repair and recombination proteins [BR:boe03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     106312404
   NER (nucleotide excision repair)
    Other NER factors
     106312404
   MMR (mismatch excision repair)
    Other MMR factors
     106312404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 106312404
NCBI-ProteinID: XP_013605373
UniProt: A0A0D3DYG9
LinkDB All DBs
Position
C8
AA seq 799 aa AA seqDB search
MLAIRSSNHFRCISSLCTKTRFSSALVSLNRQVSPFPSSYLHRAMSSSRPSAFDALMSKA
RASAKKKTTPQASNSSPSPNKRKIAKTQDADSPKAEAFPDEPRSDSPSIAEDLKKGAKTQ
DADLTKVEAFPDSDKPRSSIAKKSRTLSQTDKVDELKSKIVLLKRKPGEFDPERVCCWEK
GERVPFLFVALAFDLISAESGRIVITDILCNMLRTVIATTPDDLVATVYLAANEIAPAHE
GVELGIGEGSIIKAISEAFGRTESQVKKLNTELGDLGLVAKGSRSSQTMMFKPEPLTVVK
VFNTFRQIAKESGKDSTEKKKDRMKALLVAATDCEPLYLTRLLQAKLRLGFSNQTVLAAL
GQAAVYNEEHSKPPPKTKSPLEEAAKIVKQVFTVLPVYDIIVPALLTGGVWNLPKTCNFT
LGVPIGPMLAKPTKGVGEILNKFQDTVFTCEYKYDGERAQVHCMEDGTFEIYSRNAERNT
GKYPDVALALSRLKKPSVKSFILDCEVVAFDREKKKILPFQILSTRARKNVNVNDIKVGV
CIFAFDMLYLNGQQLIQENLDIRREKLYGSFEEDLGYFQFATALTSSDIDEIQKFLDASV
DIGCEGLIIKTLNSDATYEPAKRSNNWLKLKKDYMDSIGDSVDLVPIAAFHGRGKRTGVF
GAFLLACYDADKEEFQSICKIGTGFSEAVLEERSTSLRSRVIPTPKQYYRVGDSLNPDVW
FEPTEVWEVKAADLTISPVHRAANGIVDPDKGISLRFPRLLRVREDKKPEEATSSEQIAD
MYQAQKHNHPSNEAKGEDD
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgttagcgattcgatcatcgaatcacttccgatgcatttcttctctctgcactaaaacc
cgattctcctccgcattggtctctctcaatcgccaagtttctccctttccctcctcatac
ctccacagagcaatgtcttcttctcgcccctctgcatttgacgctctcatgtcgaaagct
cgcgcatccgccaagaagaaaacgacaccccaagcttccaattcatctccctccccgaac
aaaagaaaaatcgcgaaaacccaagacgccgattcgccaaaggcggaagcttttcccgat
gaacccagatcagattcgccgtcaattgcggaagatttgaagaagggagcgaaaacccaa
gacgccgatttgacaaaggtggaggcttttcctgattcggataaacccagatcgtcaatt
gcgaaaaagtctaggactttgagtcagacggataaagtcgacgaattgaagagtaagatt
gtgttgctgaagaggaagcctggcgaattcgatccggagagagtttgttgttgggagaaa
ggggagagagttccgtttctgtttgtggcattggcgtttgatttgatttcagctgagagt
gggaggattgtgattactgatattctgtgtaacatgttgaggactgttattgccaccact
cctgatgatttggtcgctactgtttatcttgcggccaacgagattgctcctgctcatgaa
ggggtggagttggggattggtgaaggttctattatcaaggccatctctgaagcttttggt
agaactgagtcccaggttaagaagctgaatacggaactaggagacttggggcttgtagca
aaaggaagccgttcgtcacagactatgatgttcaagccagaaccattgactgttgtcaag
gttttcaatacttttcgacaaattgctaaggaaagtggaaaagatagtacagaaaagaag
aaggatcggatgaaggcacttcttgtggcagcaacagactgtgaacctctgtacttaact
cgtttacttcaggcaaaattgcggttaggattctcaaatcagactgtcttagctgccttg
ggacaagcagctgtttataatgaagagcactcaaagccacccccaaaaaccaagtctcct
ttagaggaggctgcgaagattgttaaacaagtattcactgtgcttcctgtgtatgacatt
attgttcctgctcttctaactggcggtgtgtggaatcttcctaaaacttgtaacttcaca
cttggtgtacctattgggccaatgcttgcaaaaccaacaaaaggtgtaggcgagatactg
aataagttccaggacacagttttcacatgcgaatacaaatatgatggagaacgtgcacag
gtacattgtatggaggatggtacattcgagatatatagtcgaaatgctgaaagaaacact
gggaagtaccctgatgttgctcttgcgttatcaagattaaagaagccttctgtgaaatct
tttatcctggactgtgaggttgttgctttcgacagggagaaaaagaagattcttccgttt
cagattttgagcactcgagcgcgtaagaatgtgaacgtcaatgatatcaaagttggcgtg
tgcatctttgcttttgacatgttgtatctaaatggccagcaacttatccaggagaatctt
gatattcgccgagagaagctatacggatcatttgaggaagatcttggatatttccagttt
gcaactgctctaacatccagcgatatcgatgaaatacaaaagtttcttgacgcttctgtt
gacattgggtgtgaagggctaatcattaaaacattgaattcagatgcgacatatgagcct
gcaaagcgatccaataattggctaaaactgaagaaagactatatggacagcattggggac
tctgtggatcttgtaccaattgctgctttccatggacgtggcaaacgcacaggtgtcttt
ggtgcatttttactagcttgctacgatgctgataaggaagagttccagagcatttgtaaa
ataggtactggattttctgaagctgtgcttgaagaacggtctaccagtctccggtccaga
gtgattcctactcctaaacaatactaccgagttggagacagcctcaatccagatgtttgg
tttgagcccactgaggtctgggaagtgaaggcagctgacttgaccattagccctgtgcat
cgtgcagctaatggaattgtggatcctgataagggaatttctctacgttttcctcgttta
ctccgtgtacgggaagacaagaagccagaggaagcaacatcatctgaacagattgctgat
atgtaccaagctcaaaaacacaaccatccaagcaatgaagccaaaggtgaagatgattga

DBGET integrated database retrieval system