KEGG   Brassica oleracea (wild cabbage): 106312507Help
Entry
106312507         CDS       T04124                                 

Definition
(RefSeq) probable polygalacturonase
Organism
boe  Brassica oleracea (wild cabbage)
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_28 Pectate_lyase_3 Beta_helix
Motif
Other DBs
NCBI-GeneID: 106312507
NCBI-ProteinID: XP_013605511
LinkDB All DBs
Position
C8
AA seq 458 aa AA seqDB search
MKMIQTSLCILVVLTVSGFPMMESSVESKKGIEYMAMQCRKHKAVLTDFGAVGDGKTSNT
KAFRDAIAKLSPQAADGGVQLIVPPGNWLTGSFNLTSHFTLFIQQGATILASQVESEYPM
IPRLPSYGDARFASLIYGTNLTDVVITGNKGTINGQGKSWWLKYRNGGFNLISRPLLIEI
LYSENIQISDINLVDSPMWNIHPVYCKNVIIKNIKIDAPIDSPNTDGINPDSCTNTLIED
CSVTSGDDCIAVKSGIDQYGIATAIPTQQLSIRRLTCVSPDSAGIAIGSEMSGGIKDVRI
EDVTLINTQSAIRIKTAIGRGGYVKDIFARRFTMKNMKYVFWMTGSYKLHPIGFDPNALP
EIRNINYRDMTADNVTISAKLEGIKKDPFTGICMSNVTMALSPTTKKLQWNCTDVAGVTS
RVKPEPCSLLPSKGPAMDCHFPTDKIPIESVVLNKCTA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgattcagacaagtttgtgtatactagtggtattaacagtatccggttttccg
atgatggaatccagcgttgaaagcaagaaaggtatagaatacatggcgatgcaatgccgg
aaacacaaagcagttttgacagattttggagctgttggtgatgggaaaacctccaacaca
aaagcgtttagagatgccatcgccaagctttcaccgcaggcagctgacggtggtgtacaa
ctcattgttccgccggggaactggctcaccggaagtttcaacctcacaagccattttact
ttgtttatccaacaaggtgcaactattcttgcttctcaggttgaatctgaatatcctatg
attccacgtttgccgtcatatggtgatgcaaggtttgctagtttaatctacggaactaac
ctaacagatgttgttatcaccggtaacaaaggaacgatcaatggacaagggaagtcatgg
tggttaaagtatcgaaatggtggtttcaatttgatatcaagacctttgttgatcgaaatc
ctctactctgaaaacatacaaatctcagatatcaatttagtcgattctcccatgtggaac
attcatcctgtgtattgcaagaacgtcatcatcaaaaatattaagattgatgctcctatc
gattctcctaacaccgatggaatcaatcccgattcttgcaccaacacattaatagaagac
tgttccgttacttccggtgacgactgcatcgctgtcaaaagcggtatcgaccaatatgga
atcgcgaccgcaatcccaacacaacagctctccatccgacgtctcacttgcgtttcaccc
gacagcgcaggcatagccataggaagcgaaatgtctggaggaatcaaagacgttagaatc
gaagacgtgacgctgatcaacacacaatcagcgatcagaatcaaaaccgccataggacgt
ggaggttacgtcaaagacattttcgcaaggaggttcacgatgaagaatatgaagtacgtg
ttctggatgaccggttcgtataaacttcatcccataggcttcgatcctaatgcgttgcca
gagattagaaatatcaactaccgtgacatgacggctgacaacgttacgatctctgctaag
ttagaagggattaagaaggatccttttacggggatatgtatgtcgaatgtgactatggct
ttgtctcccaccacgaagaagctgcagtggaactgtactgatgtggccggagttacgagc
agggttaagccggagccgtgcagtttgttaccgagtaagggacctgcgatggactgtcat
tttccgacggataagatccctattgagagtgttgtgttgaacaaatgtactgcttag

DBGET integrated database retrieval system