KEGG   Brassica oleracea (wild cabbage): 106313328Help
Entry
106313328         CDS       T04124                                 

Definition
(RefSeq) spermine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
boe  Brassica oleracea (wild cabbage)
Pathway
boe00270  Cysteine and methionine metabolism
boe00330  Arginine and proline metabolism
boe00410  beta-Alanine metabolism
boe00480  Glutathione metabolism
boe01100  Metabolic pathways
Module
boe_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:boe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    106313328
   00330 Arginine and proline metabolism
    106313328
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106313328
   00480 Glutathione metabolism
    106313328
Enzymes [BR:boe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     106313328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 MTS Methyltransf_30 Methyltransf_24 Methyltransf_11 Methyltransf_23 Kelch_1 Methyltransf_4 Methyltransf_12
Motif
Other DBs
NCBI-GeneID: 106313328
NCBI-ProteinID: XP_013606576
UniProt: A0A0D3EAJ1
LinkDB All DBs
Position
C9
AA seq 362 aa AA seqDB search
MEGDGVKGLACQKTMDGNASNGNGVEKTVPSCCLKAMSCLPEEDAKCHSTVVSGWFSEPP
HPRSSGKRGKTVYFNNPMWPGEAHSLKVEKVLFKDKSDYQEVLVFESATYGKVLVLDGIL
QLTEKDEFAYQEMIAHLPLCSTPSPKNVLVVGGGDGGVLREISRHSSVEVIDICEIDKMV
IDVSKKFFPELAVGFEDPRVQLHIGDAVEFLRNSPEGKYDAIIVDSSDPVGPAQALVEKP
FFETLARALKPGGVLCNMAESMWLHTHLIEDMISVCRQTFKTVQYAWSSVPTYPSGVIGF
ILCSTDGPAVDFKNPINPIEKLDGAMTYKREMKFYNSDMHRAAFALPTFLRREVASLLSS
SS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggagggagacggcgtaaaaggtttggcatgccagaagactatggatgggaatgcgagt
aatgggaatggtgtggagaagactgtaccttcttgctgcctcaaggccatgtcttgctta
ccagaggaagatgctaagtgccactccactgttgtctctggatggttctccgaacctcct
caccctcgctcttctgggaaaagaggcaaaacagtgtatttcaataaccctatgtggcca
ggagaagcacactcactgaaagttgagaaagttctattcaaagacaagtcagactatcag
gaagtcctagtgtttgagtcagctacctatgggaaagtgcttgttctagatggtattcta
cagctgactgaaaaagatgaatttgcatatcaggagatgatagcccatctacctctatgc
tccacgccttcacctaaaaacgtcctggttgttggtggaggtgatggtggtgttctcagg
gagatttctcgccatagttctgttgaggttattgacatttgtgagattgacaagatggtt
atagatgtgtctaagaaattcttccctgagttagcggttggatttgaggatcctcgtgtt
caacttcacattggtgatgcagttgagttcctccgcaactcccctgaagggaagtatgat
gccattattgtggattcttcagatcctgttggtcctgctcaggcgcttgttgagaagcct
ttctttgaaacgttagctagagcgttgaagcctggaggagttctttgcaacatggcggaa
agcatgtggctccacactcatctcattgaagacatgatctcggtttgccgccaaacattc
aaaaccgttcagtatgcgtggagcagcgtgccaacatatcctagcggcgtgattggtttc
atcttgtgctcaaccgatggtccggctgttgatttcaagaaccctatcaatcccattgag
aaactagacggtgccatgacttataaaagagaaatgaagttttataactcggatatgcac
agagcagctttcgctttgcccacattccttagaagagaagtggcttcacttctgtcttct
tcttcttga

DBGET integrated database retrieval system